Details for Peach Locus ppa009189m

Position : sca2 ( 5`- 22958046 .. 22955748 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa009189m

Protein [Map View]
MAELTQGEVVYSPKTLQVWRALVNWFGFFFQIFLQILRALGHHPLLSSSSSASSSSASFKSLPVVELQELEHDSPAASAV
EIADTPDADSDDRIHKLTVVLDLDETLVCAYESSSLPAVVRDQATEGGLKWFELECVSSDKECDGKPKVNYVTVFERPGL
QDFLRQVSQFAELVLFTAGLEGYARPLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLAKDMRRIVIVDNNPFSFLL
QPLNGIPCIAFSAGQTHDTQLLDVLLPLLKHLSLQKDVRPVLYERFHMLEWFQKQGIPSTSWK*

DNA
ATGGCCGAGTTGACTCAGGGTGAGGTGGTCTACTCGCCCAAGACTCTCCAAGTATGGCGAGCCTTGGTGAACTGGTTCGG
CTTCTTCTTCCAGATCTTCCTCCAAATCCTCAGAGCCCTCGGTCACCACCCCCTCCTCTCTTCTTCGTCTTCGGCTTCGT
CTTCTTCCGCCTCCTTCAAATCCCTGCCGGTCGTTGAGTTGCAGGAGCTCGAGCACGACTCTCCCGCCGCCTCCGCCGTT
GAAATCGCCGACACCCCAGATGCCGACTCCGACGACCGCATCCACAAGCTCACGGTAGTTCTTGACCTGGATGAAACTCT
AGTGTGTGCATATGAGTCGTCTAGCTTGCCCGCTGTCGTTCGAGATCAAGCTACAGAAGGTGGGTTGAAGTGGTTTGAGC
TTGAATGCGTATCTTCAGACAAGGAATGTGATGGGAAACCAAAGGTCAATTATGTTACTGTCTTTGAGCGTCCCGGGTTG
CAAGACTTCTTAAGACAAGTCAGTCAGTTTGCAGAGCTGGTGTTGTTTACTGCTGGTCTTGAAGGTTATGCTAGACCACT
TGTTGACAGAATAGATGTTGATAATCTATTCAGTTGTCGACTTTATCGGCCTTCAACAACCAGCACGGAATACCGGGAGC
ATGTGAAGGATCTCTCTGGCCTAGCAAAGGATATGCGCCGAATTGTTATTGTTGACAACAACCCTTTCAGTTTCTTGTTG
CAACCTTTGAATGGAATTCCATGCATTGCATTTTCTGCTGGGCAAACACACGACACACAGCTTTTGGATGTTCTTCTTCC
ACTCCTCAAGCACCTCTCCCTGCAGAAAGATGTAAGGCCAGTGCTTTATGAAAGGTTTCACATGCTTGAATGGTTTCAAA
AGCAGGGGATTCCTTCAACAAGTTGGAAATAG