Details for Peach Locus ppa009167m

Position : sca2 ( 5`- 23474606 .. 23475520 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa009167m

Protein [Map View]
MQFKRMVEAANFEASGAMSRNEQTKSIMKTAEMRWVAAKKMEEAARAAEAVALAEIKSLTSSGGSSGYVLPEPEKMSISS
QMKSPLNLKAQEAEGWFKKKLVDAMRQIDEAHTSKLAILRKLKEATEEVKHSKQFLEEALNKVEIANRKQLAAQEALQSW
GPERDQKEQAAAYNTTNLNNFQSPDYNQNSPMNEMNKSVIVNEGPKPHLRSTVSMRDVLSRKQVLPEDFVEKKEMERGHP
EMHRVALSEMLHALREDLTFPAKVEKDGNDQKPFLTQRKKFGFIHISLPLSKPSKKKTQTLNAM*

DNA
ATGCAATTTAAGAGAATGGTAGAAGCTGCGAACTTCGAAGCATCAGGGGCAATGTCAAGGAATGAACAAACCAAGAGCAT
TATGAAGACTGCTGAAATGAGGTGGGTTGCAGCTAAAAAGATGGAAGAAGCAGCAAGGGCAGCAGAAGCTGTTGCTCTTG
CTGAAATCAAGTCTCTAACAAGCTCTGGGGGCTCATCAGGGTATGTCCTTCCAGAGCCTGAGAAAATGAGTATTAGTTCT
CAAATGAAATCTCCTCTAAACTTGAAAGCTCAAGAAGCTGAGGGCTGGTTCAAGAAGAAGCTAGTAGATGCCATGCGCCA
AATTGATGAAGCTCATACTTCTAAACTGGCCATACTAAGGAAGCTGAAAGAAGCAACAGAAGAAGTTAAACACAGTAAAC
AATTCTTGGAGGAGGCTCTAAACAAAGTGGAAATTGCGAATAGAAAGCAACTAGCTGCTCAAGAGGCTCTCCAGAGCTGG
GGACCTGAGCGTGACCAAAAGGAACAGGCTGCTGCTTATAACACCACCAACCTAAACAATTTTCAATCACCAGATTATAA
TCAGAACTCTCCGATGAATGAGATGAACAAGTCAGTCATAGTAAATGAGGGTCCAAAGCCTCATCTAAGGTCAACAGTTT
CAATGCGAGATGTTCTTAGCAGGAAGCAAGTTCTGCCTGAAGATTTTGTGGAGAAAAAGGAAATGGAACGTGGCCACCCC
GAAATGCACCGAGTGGCTTTGAGCGAAATGCTTCATGCTCTGAGGGAGGATTTAACATTTCCTGCAAAAGTTGAGAAAGA
TGGAAATGATCAAAAGCCATTTTTGACACAGAGGAAGAAGTTCGGGTTCATCCACATATCACTTCCCCTGTCCAAGCCAA
GTAAGAAAAAGACACAAACTTTGAACGCAATGTGA