Details for Peach Locus ppa009087m

Position : sca2 ( 5`- 21391381 .. 21388790 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa009087m

Protein [Map View]
MAILNVSLRGTAASTSSSSLPSWPHLSNSVPFSLSNKPVIAKFPNTTILSPPKLRLQASFGKKTRASLSATMATGGQEVL
PPALTSTSDPPPLFDGKTRLYISYQCPYAQRAWISRNCKGLEENIQLVPIDLQDRPAWYKEKVYPPNKVPSLEHNNEVKG
ESLDLIRYIDSHFEGPSLFPDDPAKREFAEELLSYTDSFNKSVFASFKEDGTKAAGAAFDYIETALSKFEDGPFFLGTFS
LVDIAYAPFLERFQPFSLEVKKYDITAGRPKLAAWFEEMNKNLAYKKTRRDPKELVESYKRRFLAQK*

DNA
ATGGCTATTTTGAACGTGAGTTTGAGAGGCACTGCTGCTTCTACTTCATCATCCTCTCTGCCCTCTTGGCCACACCTGTC
AAATTCAGTCCCTTTCTCTCTCTCTAATAAACCAGTGATAGCCAAATTTCCAAACACCACCATACTATCTCCTCCTAAGC
TTCGACTTCAAGCTTCTTTTGGAAAGAAAACCAGAGCTTCACTCTCTGCAACTATGGCAACTGGTGGGCAAGAGGTTCTG
CCACCAGCTCTGACTTCTACCTCAGACCCACCTCCGCTCTTCGATGGGAAAACAAGGTTGTATATATCTTACCAATGCCC
ATATGCACAGCGTGCGTGGATTTCCCGGAACTGTAAGGGACTGGAGGAAAATATACAATTGGTTCCTATTGATCTGCAAG
ACAGGCCTGCTTGGTACAAGGAGAAAGTCTACCCACCTAACAAGGTGCCGTCGCTGGAACACAATAACGAAGTCAAAGGA
GAGAGTCTTGATTTGATTAGATATATTGACAGTCACTTTGAAGGGCCTTCACTGTTCCCTGATGATCCTGCAAAGAGAGA
ATTTGCAGAAGAGTTGCTGTCCTACACAGACTCCTTCAATAAATCTGTGTTTGCTTCATTTAAAGAGGACGGAACCAAGG
CAGCTGGTGCTGCATTTGACTATATTGAAACTGCTCTTTCCAAATTTGAAGATGGACCTTTCTTTCTTGGCACTTTCAGT
CTGGTGGATATAGCTTATGCTCCATTCCTTGAAAGATTTCAGCCTTTCTCACTGGAAGTGAAGAAGTATGACATCACTGC
AGGCAGGCCTAAACTGGCAGCATGGTTTGAGGAGATGAACAAAAATTTAGCTTACAAAAAAACCCGGCGTGATCCCAAAG
AGCTCGTTGAAAGCTACAAGAGACGCTTTTTGGCACAGAAATGA