Details for Peach Locus ppa008890m

Position : sca2 ( 5`- 21712491 .. 21714590 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa008890m

Protein [Map View]
MASDMEGVKYEEEFILNSRGLKLFTCRWLPKNTTPKALIFICHGYAMECSITMNSTAIRLARAGFALYGIDYEGHGKSAG
LEGYVKSFDDVVDDCTNHFTNICESRENKGKMRYLLGESMGGAVALLVHRKKPKFWDGAVLVAPMCKIADELRPSPFVIS
ALTKLCKFIPTWKIIPTNDIIDVAFKVPEIREQIRENPYCYKGRPRLQTGYELLRVSSDLEQRLEEVTLPFLVLHGEDDK
VTDKSVSKQLHDVASSQDKTLKMYPNMWHGLLYGETPDNIEIVFSDIISWLENRSAFGNSRLEGELKRGNDDLSK*

DNA
ATGGCCTCTGATATGGAAGGTGTCAAATATGAAGAGGAGTTCATCTTAAATTCTCGAGGCTTGAAGCTTTTCACATGCAG
ATGGCTCCCAAAAAACACCACACCCAAAGCCTTAATCTTCATCTGTCATGGATACGCCATGGAATGCAGCATCACCATGA
ACAGTACTGCAATCAGGCTTGCCAGAGCAGGCTTTGCCTTATATGGGATTGACTATGAAGGCCATGGAAAATCAGCAGGC
CTTGAAGGCTATGTCAAAAGCTTTGATGATGTAGTGGATGACTGTACCAATCACTTCACAAACATATGTGAAAGCAGAGA
GAACAAAGGAAAAATGAGGTATCTGTTGGGAGAGTCAATGGGAGGAGCCGTGGCTCTGCTGGTGCACAGAAAAAAGCCAA
AGTTTTGGGATGGTGCAGTTTTGGTTGCACCTATGTGTAAGATTGCAGATGAATTGAGGCCATCTCCTTTCGTCATCAGT
GCTTTGACAAAGCTCTGCAAGTTCATTCCAACCTGGAAAATAATCCCAACAAATGATATCATCGACGTTGCTTTCAAAGT
ACCCGAGATAAGAGAACAGATTAGAGAAAACCCCTACTGTTACAAAGGCCGGCCTCGGCTTCAAACCGGCTACGAGCTTT
TGAGGGTGAGCTCGGATCTTGAGCAGAGGCTTGAAGAGGTCACCTTGCCATTCCTAGTTTTACATGGGGAAGACGATAAG
GTGACAGATAAATCAGTCAGCAAACAGCTTCATGACGTGGCTTCTAGCCAGGACAAGACATTGAAGATGTACCCAAATAT
GTGGCATGGTCTGCTCTACGGAGAAACACCAGACAACATTGAGATTGTGTTTTCAGACATAATCAGCTGGTTAGAGAACA
GAAGTGCTTTTGGCAATTCAAGGTTGGAGGGAGAGTTGAAACGTGGAAATGACGATTTGTCCAAGTAG