Details for Peach Locus ppa008488m

Position : sca2 ( 5`- 22784705 .. 22787355 -3` )
Annotation : [B2G] PREDICTED: exostosin-2-like [Glycine max]
External links : CoGe
PGDD synteny : ppa008488m

Protein [Map View]
MRGSSWNRRTVQRLRQALISTVGSMKIKLLLCCCIGFTLIALASRASDFMGWTNHTAALERFSDSRKGYSIVMNTWKRYD
LLKQSISHYSRCPRLDSIHIVWSEPSPPSDSLRKFLYHIVQLNTRDGRQVELKFDINTEDSLNNRFKEIKDLRTDAIFSI
DDDVIFPCPSVEFAFDVWQSASDTMVGFVPRMHWVDPTKGDKNHYIYGGWWSVWWTGTYSMVLSKAAFFHKKYLSLYTNE
MPASIREFITKNRNCEDIAMSFLVANATGAPPIWVKGKIFEIGSTGISSLGGHSEKRTHCIDRFVAEFGRMPLEPTAVKA
VDSRNIWFW*

DNA
ATGAGAGGGAGCTCGTGGAACCGTCGAACGGTACAGAGGCTGCGGCAGGCGTTGATCTCGACCGTTGGATCCATGAAGAT
CAAGCTTCTGCTCTGCTGTTGTATCGGCTTCACGCTCATCGCGCTCGCCAGCCGAGCTTCGGACTTTATGGGATGGACCA
ATCACACTGCTGCTCTGGAGCGGTTCTCTGATTCACGGAAAGGATACTCTATTGTAATGAACACTTGGAAGAGATATGAT
CTTTTGAAGCAGTCAATTTCTCACTATTCTAGATGCCCTCGGCTTGATTCGATACATATTGTGTGGAGTGAGCCAAGTCC
TCCTTCAGATTCTCTGAGAAAATTTCTATACCACATTGTACAATTGAATACTAGAGATGGGCGACAAGTTGAACTGAAAT
TTGATATCAATACCGAAGACAGCTTGAACAACAGATTTAAAGAAATTAAGGATCTGAGAACAGATGCCATTTTCTCAATT
GACGATGATGTTATATTCCCTTGCCCTTCAGTAGAATTTGCTTTCGATGTTTGGCAAAGTGCATCAGATACAATGGTTGG
ATTCGTGCCTCGCATGCACTGGGTTGATCCGACCAAAGGTGATAAGAATCACTACATTTATGGCGGATGGTGGTCAGTTT
GGTGGACAGGTACATACAGTATGGTACTGTCTAAGGCAGCCTTCTTCCACAAAAAGTACCTAAGTCTGTACACAAATGAA
ATGCCAGCATCAATCAGAGAATTTATAACCAAGAACAGGAACTGTGAAGACATTGCGATGTCTTTTCTCGTAGCAAATGC
AACTGGTGCTCCTCCAATATGGGTGAAAGGCAAGATATTTGAGATTGGTTCAACTGGAATCAGTAGCTTAGGAGGTCACA
GTGAAAAAAGAACCCACTGCATCGACAGATTTGTTGCCGAGTTTGGACGAATGCCATTGGAACCGACGGCTGTGAAGGCT
GTTGACAGTCGCAACATCTGGTTTTGGTGA