Details for Peach Locus ppa008409m

Position : sca2 ( 5`- 21697891 .. 21699890 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa008409m

Protein [Map View]
MASLPYADVDFSLRALSGRAEGFGRFAIGGLHGPLYFVTTLADDGPGSLREGCRKQEPLWIVFEVSGTIHLSSYLSVSSY
KTIDGRGQRVKLTGKGLRLKECEHIIVCNLEFQGGRGHDVDGIQIKPNSRHIWIDRCSLRDYDDGLIDITRQSTDITISR
CYFAQHDKTMLIGADPSHVGDRCIRVTIHHCFFDGTRQRQPRLRFGKVHLYNNYTRNWGIYAVCASVESQIYSQCNIYEA
GNKKKTFEYYTEKAADREEAKSGFISSEGDLFLNGAQPCALTGFNQECMFHPSEFYPHWTMEAASDSLKTILQILTGWQS
IHRPAEQAQAVTV*

DNA
ATGGCCTCGCTACCGTACGCCGACGTGGATTTCAGCTTGAGAGCATTGTCCGGTCGGGCCGAGGGCTTCGGCCGGTTCGC
CATCGGCGGCCTCCACGGGCCGCTCTATTTCGTCACCACTTTGGCAGATGATGGTCCAGGCTCACTTCGTGAAGGATGTC
GAAAACAAGAACCACTGTGGATTGTCTTTGAGGTTTCTGGCACCATTCACCTTTCGTCTTACTTGAGTGTGTCATCTTAT
AAGACAATTGATGGACGAGGCCAGAGAGTAAAGCTCACAGGAAAGGGCCTTAGACTGAAGGAATGTGAACACATAATTGT
CTGCAACCTTGAGTTTCAAGGCGGTAGAGGACATGATGTTGATGGCATTCAGATAAAACCGAATTCTAGGCACATTTGGA
TAGACCGATGCAGCCTTCGTGATTATGATGATGGACTCATAGATATCACCAGACAAAGTACAGATATAACCATCTCTAGA
TGTTACTTCGCACAACATGACAAGACAATGCTTATTGGAGCAGACCCCTCCCACGTTGGCGATAGATGCATTCGGGTGAC
AATTCATCATTGTTTTTTTGATGGGACAAGGCAAAGACAACCTCGCCTTAGATTTGGGAAAGTTCATCTTTACAACAATT
ACACTCGAAACTGGGGTATATATGCTGTTTGCGCCAGCGTAGAATCCCAGATATACTCCCAATGCAACATATATGAAGCA
GGAAATAAGAAAAAGACTTTTGAATATTATACAGAAAAGGCAGCAGACAGAGAAGAGGCAAAATCTGGCTTCATAAGTTC
TGAGGGCGACCTATTCCTGAACGGAGCTCAACCATGCGCATTAACAGGGTTCAATCAAGAATGCATGTTCCATCCAAGTG
AATTTTATCCACATTGGACTATGGAAGCAGCCTCAGATTCTCTTAAAACTATTCTCCAAATTCTTACAGGTTGGCAATCC
ATTCATAGGCCAGCAGAGCAGGCGCAGGCGGTAACTGTATAG