Details for Peach Locus ppa008095m

Position : sca2 ( 5`- 21896666 .. 21897703 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa008095m

Protein [Map View]
MKFESVFKVSRKTFSYICSLVKEDMMTSSSNFSYSNGKQLSLNDQVAVALRRLSSGESLVSIGDSFGINRSTVSHITWRF
VEAMEERGLHHLCWPTKHGEMEEIKSKFEKIRGLPNCCGAIDITHILMTHPTPGSPDDVWLDCEEKCSMILQAIVDPDMR
FRNIITGWPGSLSDELVLRSSGFFKLCEERSCLNGKKLVLSEGTEVREYIVGDSGFPLLQWLFTPYKGRELSNYQCEFNK
RLSATQMVARRALVRLKEMWKIIQGVMWTPDKNKLPRIILVCCILHNIVIDLEDEAQDEMPLSHHHDSGYRQQTCESADN
TASLLREKLAIYLSGEKNLASVLPG*

DNA
ATGAAATTTGAATCTGTCTTCAAAGTTTCGAGAAAGACATTCAGTTACATCTGTTCACTTGTAAAGGAAGATATGATGAC
TAGCAGCTCAAACTTCAGTTATTCAAATGGAAAGCAGTTGTCTCTAAATGACCAAGTTGCTGTTGCTCTTAGGAGGCTTA
GCTCTGGTGAGTCCTTAGTGAGCATCGGTGACTCATTTGGGATAAACCGATCAACCGTTTCTCACATTACCTGGAGGTTT
GTGGAAGCAATGGAAGAAAGAGGGCTGCACCATCTTTGTTGGCCTACAAAGCATGGTGAAATGGAGGAGATAAAGTCCAA
GTTTGAGAAAATCCGCGGCCTTCCAAATTGTTGTGGTGCAATTGACATCACACACATCCTGATGACCCACCCTACACCGG
GCTCACCAGATGATGTCTGGCTCGATTGCGAAGAAAAATGCAGCATGATCTTACAGGCAATCGTTGACCCGGATATGAGG
TTCCGTAACATTATTACAGGATGGCCAGGAAGTTTGAGTGATGAGCTAGTCCTTCGGAGTTCAGGTTTTTTCAAGCTGTG
TGAAGAAAGAAGTTGTTTAAACGGGAAGAAGTTGGTGCTTTCAGAAGGAACAGAAGTAAGAGAATACATAGTTGGAGATT
CTGGTTTTCCTCTCTTGCAATGGCTTTTCACTCCTTACAAGGGGAGAGAGCTCTCAAACTATCAGTGCGAGTTTAACAAG
CGGCTCTCTGCGACGCAGATGGTGGCGCGCAGGGCGTTGGTGAGGCTGAAGGAGATGTGGAAGATAATTCAAGGGGTAAT
GTGGACGCCTGATAAGAACAAGTTGCCAAGGATTATTCTGGTTTGCTGTATTCTGCACAATATAGTTATTGATTTGGAGG
ATGAGGCGCAAGATGAAATGCCCTTGTCTCATCATCATGATTCTGGTTACCGGCAACAAACTTGCGAATCTGCTGACAAT
ACTGCCTCTCTCCTGAGAGAGAAGCTTGCTATTTACTTGTCTGGAGAGAAGAACCTTGCTTCAGTCTTACCTGGTTGA