Details for Peach Locus ppa008050m

Position : sca2 ( 5`- 23712225 .. 23710355 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa008050m

Protein [Map View]
MSKPSSRIIQGLLRFHHNQIAKPSSPLTSSRRTYHSNNGPLPQFPSHPKPVVGGGGSSSGPGLGLGLGLRFFSFKPPNFS
KVNAKKVFDKPLSAATSAFSRYQEAIGLQIEAFWKRNNLVLLGVGALVVCALLWRVMFGIASTFVGLSEGMAKYGFLALS
SAIVAFAGLHIRSRFTINPDKVYRIAMRRLNTSAGILEVMGAPLSGSDLRAYVMSGGGVTLKKFKPTFRSKRCFLIFPVR
GSERKGLVSVEVKKKKGQYDMKLLAVDIPMASGPDQRLFLIGDEEEYKVGGGLIAELRDPVVKAMAATKEFDSLDQIEEE
EDAERELQEAERKHREEIEKLEKDGSQ*

DNA
ATGTCAAAACCCTCGTCTCGAATCATCCAAGGTCTGCTCAGATTTCACCACAATCAAATCGCAAAACCCTCGTCCCCACT
CACCAGTTCCAGGAGGACCTACCACTCCAACAATGGGCCTCTTCCCCAATTCCCCTCTCACCCAAAACCAGTCGTCGGCG
GCGGTGGCAGCTCCTCCGGGCCGGGGCTGGGCCTAGGCCTTGGCCTGAGGTTCTTCTCCTTCAAGCCACCGAATTTCAGC
AAAGTCAATGCGAAGAAGGTGTTCGATAAGCCGCTCTCCGCCGCCACCTCGGCTTTCTCGCGGTACCAGGAGGCCATAGG
GTTGCAGATTGAGGCGTTCTGGAAGAGGAACAATCTGGTGCTCTTGGGCGTTGGAGCACTAGTGGTGTGTGCTTTGCTAT
GGAGGGTCATGTTTGGGATTGCTAGCACCTTCGTTGGACTCTCTGAAGGGATGGCCAAGTATGGCTTTCTTGCCCTTTCT
TCTGCCATTGTCGCCTTCGCTGGCCTTCATATCCGCTCAAGATTCACAATCAATCCTGATAAAGTTTATAGAATTGCCAT
GAGGAGGCTTAACACTTCTGCTGGGATTCTTGAGGTTATGGGTGCCCCTCTCTCAGGATCAGACCTAAGAGCCTATGTCA
TGTCCGGAGGTGGGGTTACACTAAAGAAGTTCAAGCCAACTTTTAGGAGCAAGCGGTGTTTCCTCATTTTCCCAGTACGA
GGCTCTGAGAGAAAGGGTCTGGTCAGTGTCGAAGTAAAGAAGAAAAAAGGCCAGTATGATATGAAGCTACTGGCAGTTGA
CATTCCCATGGCATCAGGGCCTGACCAGCGCTTATTTCTGATTGGTGATGAAGAAGAGTACAAAGTTGGTGGTGGACTGA
TAGCTGAGCTGAGAGATCCGGTTGTGAAAGCAATGGCTGCAACCAAGGAGTTTGATAGTCTTGATCAGATTGAAGAAGAG
GAGGATGCTGAAAGAGAACTTCAGGAGGCAGAAAGAAAGCACCGCGAAGAAATTGAGAAGCTTGAAAAGGATGGGTCACA
GTGA