Details for Peach Locus ppa008009m

Position : sca2 ( 5`- 23748025 .. 23745316 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa008009m

Protein [Map View]
MEALVCRKLGDPTAPISGGGAEKAIVVEKNHPIPELVSPTSARVRVKATSLNYANYLQILGKYQEKPPLPFIPGSDYSGV
VDAVGPSVSKFKVGDPVCSFAALGSFAQFIVADQTELFGVPEGCDLVAAGALPVAFGTSHVALVHRANLTSGQVLLVLGA
AGGVGLAAVQIGKVVGAIVIAVARGAEKVQYLKSLGVDHVVDSSTQNLIQSVKDFLKTRKLKGVDVLYDPVGGKLTKEAM
KVLSWGANILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYRIHRPAVLEDSLKELLSWVARGLITIRISHTYCLPEAN
LAFSAIKDRKAIGKVMLVLDDQTSVKSKL*

DNA
ATGGAGGCTCTGGTTTGCAGAAAATTGGGAGACCCAACAGCACCCATTTCAGGAGGAGGAGCAGAGAAAGCAATAGTGGT
GGAGAAGAATCATCCAATTCCTGAATTGGTGTCTCCCACATCGGCGAGGGTGAGGGTGAAAGCTACGAGCTTGAACTACG
CCAATTATCTACAGATATTGGGCAAGTACCAAGAGAAGCCACCCCTCCCTTTCATCCCTGGCTCTGACTATTCCGGCGTC
GTCGACGCCGTGGGACCTTCTGTCTCCAAGTTCAAAGTCGGCGACCCTGTTTGCTCTTTTGCCGCCCTCGGCTCCTTTGC
CCAATTCATCGTCGCCGACCAGACCGAGCTGTTTGGAGTGCCAGAGGGGTGTGATCTGGTAGCTGCTGGTGCACTGCCTG
TTGCATTTGGGACATCACACGTGGCTCTTGTTCACCGGGCCAATTTGACCTCCGGCCAAGTATTGCTGGTTCTTGGTGCA
GCTGGAGGTGTTGGTCTTGCAGCTGTACAGATTGGCAAGGTTGTTGGAGCCATTGTTATTGCTGTTGCTAGGGGAGCTGA
GAAGGTGCAGTATTTGAAGTCATTGGGTGTTGATCATGTCGTGGACTCGAGCACTCAGAATCTTATCCAAAGTGTCAAGG
ACTTCTTGAAAACCAGAAAGCTTAAAGGGGTTGACGTTTTGTATGATCCAGTTGGAGGCAAGCTTACTAAAGAGGCCATG
AAGGTTTTGAGTTGGGGGGCCAACATTTTGGTCATAGGCTTTGCCAGTGGAGAGATCCCTGTTATCCCTGCAAATATTGC
CCTTGTTAAGAACTGGACAGTGCATGGACTTTACTGGGGTAGCTACAGAATTCATCGACCAGCTGTTCTTGAAGATTCAC
TCAAGGAGCTACTATCCTGGGTGGCAAGAGGCTTGATCACCATCCGCATCTCTCATACTTATTGCCTGCCAGAGGCCAAT
CTTGCGTTTTCTGCCATCAAAGATAGGAAAGCCATTGGAAAAGTGATGCTTGTTCTTGATGACCAGACAAGTGTAAAATC
AAAGCTTTAA