Details for Peach Locus ppa007992m

Position : sca2 ( 5`- 23361507 .. 23363616 -3` )
Annotation : [B2G] hypothetical protein RCOM_0688330 [Ricinus communis]
External links : CoGe
PGDD synteny : ppa007992m

Protein [Map View]
MEVKLMEVSLLSKLYLVVSVPRRSTCKVGLLGKFFRFLLLGHCYKPTTTGGDSESLGPHGISAATLGVWALVYDLFNFEI
TSQVPEDLSQHVVSSKKAQANWYRKLVETWREAKQPPRTEEEAARLVIQTLKGHKKADVQGLLDFYGLPRPHSLVKVPAG
VDAKAVPDGDGVTVYVSTADPRESSCVMSDVQIAAIQRSEARADKNYTKADELHQKIIDAGYRVLNVQNEEILARKYRIR
LRGIDAPEILMPYGQVAKEELVKLLEGKCLRVLVYGEERYGRCVADVYCNGIFAQEVMLKKGGAWHYSAYDAPNLQDGKK
RLGGGKLGYGLHQTLRSHGIGERIGVKDR*

DNA
ATGGAAGTGAAATTAATGGAGGTTTCCCTGCTCTCTAAATTGTATCTGGTAGTCTCTGTGCCCAGGAGGAGCACTTGCAA
AGTGGGGTTATTGGGAAAGTTCTTCAGGTTCCTCCTATTGGGGCATTGCTATAAACCAACAACCACTGGCGGCGACTCTG
AGTCGCTTGGCCCTCACGGCATCTCTGCTGCCACACTCGGCGTTTGGGCTCTTGTCTACGACCTTTTCAACTTCGAGATC
ACCTCTCAAGTCCCAGAAGATCTCAGTCAACATGTTGTCTCATCCAAGAAGGCTCAAGCTAACTGGTATAGAAAACTAGT
TGAGACATGGAGAGAAGCAAAACAACCACCAAGAACAGAGGAAGAGGCAGCTAGGCTTGTCATACAAACCCTCAAGGGAC
ACAAAAAGGCTGATGTTCAGGGCTTATTGGATTTCTATGGTCTCCCTCGTCCCCATTCTCTTGTCAAAGTTCCTGCTGGG
GTTGATGCAAAAGCTGTTCCAGATGGCGATGGAGTGACAGTTTATGTCAGCACAGCAGATCCCAGAGAATCCTCCTGTGT
TATGAGCGATGTGCAGATAGCAGCCATCCAAAGATCAGAAGCACGCGCTGATAAGAATTATACTAAGGCAGATGAACTTC
ACCAAAAAATCATTGATGCTGGATATCGGGTACTGAATGTTCAAAACGAGGAGATCCTTGCTCGAAAGTATCGAATTCGA
CTGAGGGGCATAGACGCACCGGAGATTTTAATGCCGTATGGACAAGTAGCCAAAGAGGAGCTGGTTAAGCTTCTTGAGGG
CAAGTGCTTGAGGGTCCTTGTCTATGGGGAAGAACGTTATGGCCGCTGTGTGGCTGACGTATACTGCAATGGCATATTTG
CACAGGAAGTAATGCTCAAGAAGGGTGGTGCATGGCATTACTCAGCCTACGATGCTCCGAATTTGCAAGATGGGAAGAAG
AGGCTCGGCGGAGGCAAATTGGGTTATGGGCTTCATCAAACCCTGAGAAGCCATGGGATTGGAGAAAGGATAGGCGTCAA
AGACAGATGA