Details for Peach Locus ppa007874m

Position : sca5 ( 5`- 18231548 .. 18230487 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa007874m

Protein [Map View]
MSDVEEKMKMLGCSRATAQQEIGDTFAERAEAYYKRRPQLLSLLRDLYNSYLTLSDRYIQTVAKTQHHRPPSSQISVIDN
DYYDYDDQEEEEDDAYTSHIDSDVESSLSYQQLPPTLLLAASVATQHDETMLFDLDSIVTEIVVKNVEYDILLDEANMTE
RRYKDASRKIELQKSLLEVLESERLILLNENAKLGYKVGALVEENKALASESLFIRRKAGELARCLLKTREDQRVCMLSR
KIEDLQGQIYGLEKRNKDYYEQLVKRDQRSFQLVQEEEESCNINKSKINGNQVNLEVCFQIRKINRRLIKRGNSNGSGKE
IGVGKEKKGSSSSLWERVKNMDLFLCGGNQNST*

DNA
ATGTCAGATGTGGAAGAGAAGATGAAGATGTTGGGATGTAGCAGAGCCACAGCTCAACAAGAGATTGGGGACACCTTCGC
TGAACGAGCTGAAGCTTACTACAAAAGACGTCCTCAGCTCCTCTCCCTGCTTCGAGACTTGTACAATTCCTACCTCACCT
TATCTGACCGTTACATTCAAACTGTCGCCAAGACTCAGCATCACCGTCCACCCTCTTCCCAAATCTCAGTAATAGATAAT
GACTACTATGACTATGACGACCAAGAAGAAGAAGAAGATGATGCTTACACAAGCCACATTGATTCGGACGTAGAGAGTTC
CCTCTCCTATCAGCAATTGCCTCCAACATTACTACTCGCTGCTTCTGTTGCTACTCAACATGATGAGACCATGTTGTTTG
ATTTAGATTCCATCGTTACGGAGATTGTGGTGAAGAATGTCGAATATGATATCTTACTTGATGAGGCCAACATGACGGAG
AGGCGATACAAGGATGCATCCAGGAAGATAGAGCTGCAGAAGAGCTTGCTAGAGGTGTTGGAGTCTGAGAGGCTCATCTT
GCTCAATGAGAATGCCAAGTTGGGGTATAAAGTGGGTGCCTTGGTGGAAGAGAACAAAGCCCTTGCGTCCGAGTCTCTCT
TCATCAGGAGGAAGGCTGGCGAGCTAGCTCGCTGTTTGCTCAAGACGAGGGAAGACCAGAGGGTGTGCATGCTTAGCCGT
AAAATCGAGGACCTTCAGGGACAGATTTATGGCTTGGAGAAGAGGAACAAGGACTACTATGAGCAACTTGTGAAGAGAGA
CCAACGATCCTTTCAACTTGTACAAGAAGAAGAAGAGAGTTGCAACATCAACAAGAGCAAGATAAATGGTAATCAGGTGA
ATTTGGAGGTTTGCTTTCAGATACGGAAGATTAATCGGAGGCTGATAAAGAGAGGTAATAGTAATGGTAGTGGGAAGGAG
ATTGGCGTCGGAAAGGAGAAGAAGGGTTCTTCTTCCAGTTTGTGGGAAAGGGTCAAGAACATGGATTTGTTTCTATGTGG
AGGTAATCAAAACTCTACGTAA