Details for Peach Locus ppa007719m

Position : sca2 ( 5`- 22984567 .. 22982105 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa007719m

Protein [Map View]
MNCPSDWPEPIVRVQSLSETGVFPDRYIKPPTQRPTPISSNSDQATHTNIPIIDFQGLDDDHLRATTLGQISEACRDWGF
FQVVNHGVSPGLMDRNQEVWRQFFHLPMELKQAYANSPKTYEGYGSRLGVEKGAILDWSDYYFLHYLPLSLKDHDKWPAL
PGYARQVIDEYGKEVVKLCGRILKILSLNLGLEQDFLQKGFGGEDIGACLRVNFYPKCPQPDLTLGLSSHSDPGGMTVLL
PDQHVAGLQVRKDDTWITVKPAPHAFIVNIGDQIQVLSNATYKSVEHRVIVNPAKERLSLAFFYNPKSDIAIEPAKELVT
PERPALYPPMTFNEYRLYIRLNGPRGKSQVDSLKSPRK*

DNA
ATGAACTGCCCATCGGATTGGCCAGAACCAATAGTCCGGGTCCAGTCCTTGTCCGAGACCGGTGTCTTTCCAGACCGATA
CATCAAGCCCCCAACCCAAAGACCAACCCCAATCTCCTCCAATTCTGATCAAGCCACCCATACCAACATCCCAATCATTG
ACTTCCAAGGCTTGGACGACGATCATCTGCGAGCCACCACACTCGGCCAAATTTCTGAGGCCTGCCGGGACTGGGGGTTC
TTCCAAGTCGTGAACCATGGCGTTAGCCCCGGTTTGATGGACCGGAACCAGGAGGTTTGGCGCCAATTCTTCCATTTGCC
GATGGAGCTGAAGCAAGCCTACGCCAACTCACCCAAGACCTATGAAGGGTACGGCAGCAGGCTTGGGGTTGAGAAAGGTG
CCATTCTTGACTGGAGTGACTATTATTTCCTTCACTATCTTCCATTGTCCTTGAAGGACCACGACAAGTGGCCGGCCCTC
CCCGGCTATGCCAGGCAAGTAATAGATGAGTATGGGAAGGAAGTAGTGAAGCTTTGTGGGAGGATATTGAAGATTTTATC
ACTAAACCTTGGATTAGAACAAGACTTTCTCCAAAAGGGGTTTGGTGGTGAGGATATTGGGGCATGCTTAAGGGTTAATT
TTTATCCAAAGTGCCCTCAGCCTGACCTGACGCTGGGCCTATCATCCCACTCAGATCCTGGCGGCATGACCGTACTACTC
CCAGATCAACATGTCGCAGGTTTACAGGTCCGAAAAGATGACACTTGGATCACTGTCAAGCCAGCTCCACACGCTTTTAT
TGTCAATATTGGTGATCAAATTCAGGTTCTAAGTAACGCAACATACAAGAGCGTAGAGCACAGAGTGATCGTAAACCCAG
CAAAGGAGAGACTCTCACTGGCCTTCTTCTACAATCCGAAGAGCGACATAGCCATAGAGCCGGCAAAGGAGCTTGTCACC
CCAGAAAGACCTGCGCTCTACCCTCCCATGACATTCAACGAGTACAGGCTTTACATAAGATTGAATGGCCCTCGAGGCAA
ATCCCAAGTCGACTCTTTAAAGTCTCCACGAAAATAG