Details for Peach Locus ppa007662m

Position : sca2 ( 5`- 21116330 .. 21114091 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa007662m

Protein [Map View]
MATLSPRFLFSKGVVSQPANTPPVTSFLETHPGAYTTSRTHKDASFVLFWERQLKRLVDSVAILYNSNPQLLFGPNKTTS
LSLPSLSSNSPLLQSEVRELVNRSMKRVLPIALNERSEGEELSITALVSGNLEKLSENESEGLDHERFGNGVFDVSIYIG
TYVPTVFGIEGNGAHLAVVGRGRDDASAKYSDWVRIRKSLERLRPPNGTELLLSNDGDRILEGTVSNFFVVCRKDNDEAK
GQSVHCFEVQTAPIIDHVLPGIIRQLVIEVCLSKGIPFREVAPSWSESEFWAEAFITSSLRLLQHAERISFPSSWESLNS
KSWEEISWKDKHFEEGPGMVTTIIQKEVMEKAASEGYFLS*

DNA
ATGGCGACTTTAAGCCCCAGGTTCTTGTTCAGCAAGGGCGTCGTTTCACAGCCCGCCAACACTCCACCGGTTACAAGCTT
CCTCGAAACGCATCCAGGAGCGTACACGACGTCTCGCACTCACAAAGACGCGTCGTTCGTGCTGTTCTGGGAACGACAGT
TGAAGAGACTGGTGGACTCAGTAGCAATTCTATACAATTCGAATCCTCAGCTTCTGTTCGGACCCAACAAAACGACGTCG
CTTTCGTTGCCGTCGCTCTCCTCCAACTCCCCTTTGCTCCAGTCAGAGGTTCGCGAGCTCGTGAATCGTTCGATGAAACG
AGTGTTGCCGATTGCTTTGAATGAGAGGAGTGAGGGAGAAGAACTGTCAATTACAGCTCTGGTCAGTGGCAATTTGGAGA
AATTGAGTGAGAATGAGAGTGAGGGCTTGGACCATGAAAGATTTGGCAATGGGGTTTTTGATGTGAGTATTTACATTGGG
ACTTATGTGCCAACTGTGTTTGGTATCGAAGGAAACGGTGCGCATTTGGCTGTGGTGGGTCGTGGGAGAGACGATGCTTC
TGCTAAGTATTCGGATTGGGTGAGGATTAGGAAGTCTTTGGAGAGGTTGAGGCCTCCCAATGGGACCGAGCTCTTGTTGT
CTAATGACGGTGACCGGATTCTTGAGGGGACGGTCTCAAACTTCTTTGTCGTCTGCCGGAAGGATAACGATGAAGCTAAG
GGGCAAAGTGTGCACTGTTTTGAAGTACAGACAGCTCCTATTATTGATCATGTCCTTCCAGGAATTATACGCCAATTGGT
CATTGAAGTATGCTTGAGCAAGGGAATCCCCTTTCGAGAAGTTGCACCATCGTGGTCAGAGAGTGAATTTTGGGCAGAGG
CGTTCATTACAAGTAGCTTGAGACTTCTGCAGCACGCGGAGAGAATTAGTTTTCCAAGTTCATGGGAATCACTAAATTCT
AAATCTTGGGAGGAGATCTCATGGAAAGACAAACATTTTGAGGAGGGTCCTGGGATGGTCACTACAATAATCCAGAAAGA
GGTCATGGAGAAAGCAGCTTCAGAAGGGTACTTTCTCAGTTAG