Details for Peach Locus ppa007618m

Position : sca2 ( 5`- 22456180 .. 22457618 -3` )
Annotation : [B2G] gdp-d-mannose pyrophosphorylase
External links : CoGe
PGDD synteny : ppa007618m

Protein [Map View]
MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVSEVVLAINYQPEVMMTFLKEFETKVGIKITCSQE
TEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGKVQKF
VEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPNIAAENKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKN
SSSKLARGSNVVGNVLVDETAKIGEGCLIGPDVAIGPGCVVESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWAR
VENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILKPEIVM*

DNA
ATGAAGGCACTCATTCTTGTTGGAGGTTTTGGAACACGTTTGCGGCCATTGACACTCAGTGTCCCTAAGCCGCTTGTTGA
ATTTGCAAACAAACCCATGATCCTGCATCAGATAGAGGCTCTTAAGGCAATTGGTGTTAGCGAAGTGGTTCTGGCGATCA
ATTACCAACCAGAGGTGATGATGACTTTCCTGAAGGAGTTTGAGACAAAGGTTGGCATCAAGATCACATGCTCACAAGAG
ACTGAGCCCCTTGGTACTGCTGGACCTCTGGCTCTTGCTAGAGACAAACTGATAGATGATTCTGGCGAGCCCTTCTTTGT
CCTTAACAGTGATGTTATCAGCGAGTACCCATTTAAGCAAATGATCGAATTCCATAAATCCCATGGAGGAGAAGCTTCCA
TAATGGTGACCAAGGTGGATGAGCCATCGAAATATGGAGTGGTGGTTATGGAAGAATCTACAGGGAAAGTTCAGAAATTT
GTAGAGAAACCAAAACTGTTTGTTGGTAACAAAATCAATGCTGGAATATACCTGTTGAACCCCTCAGTTCTTGATCGAAT
TGAGCTGAGACCAACTTCAATTGAGAAAGAGGTATTCCCAAATATTGCAGCAGAGAATAAGCTCTTCGCAATGGTCCTTC
CAGGGTTTTGGATGGACATTGGGCAACCAAGGGATTATATTACAGGCCTGAGACTCTACTTGGACTCATTGAGGAAGAAC
TCTTCATCTAAGTTGGCCAGAGGCTCCAATGTTGTGGGAAATGTTCTGGTGGATGAGACTGCCAAAATTGGAGAGGGGTG
CCTGATTGGACCAGATGTTGCAATTGGTCCGGGTTGCGTTGTTGAGTCAGGAGTTAGGCTATCTCGCTGTACAGTAATGC
GTGGAGTCCGGATCAAGAAGCATGCTTGCATTTCCGGCAGTATCATCGGATGGCACTCCACAGTTGGACAATGGGCTCGT
GTAGAGAACATGACTATCCTCGGAGAAGATGTTCATGTAAGCGATGAAATTTACAGTAATGGAGGTGTGGTTTTGCCCCA
CAAAGAAATCAAGTCGAGCATTTTGAAGCCAGAAATTGTAATGTAG