Details for Peach Locus ppa006859m

Position : sca2 ( 5`- 22702458 .. 22704685 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa006859m

Protein [Map View]
MEASIGCCSPRAFLPGVSTHQHSTALVAPPSISPSFSSKSLKSSSLFGEPLRQVPRSSLKVSKTKQSSLVTRCAIGESLE
VFLAKATPDKGLIRLLISMGEALRTISFKVRTASCGGTACINSFGDEQLAVDMLADKLLFEALSYSHFCKYACSEEVPEL
QDMGGPVEGGFSVAFDPLDGSSIVDTNFTVGTIFGVWPGDKLTGITGRDQVAAAMGIYGPRTTYVLAIKGFPGTHEFLLL
DEGKWQHVKETTEIGEGKLFSPGNLRATFDNPDYDKLINYYVKEKYTLRYTGGMVPDVNQIIVKEKGVFTNVISPTTKAK
LRLLFEVAPLGLLIENAGGYSSDGHQSVLDKVIINLDDRTQVAYGSKNEIIRFEETLYGSSRLKAGVPVGAAA*

DNA
ATGGAGGCCAGCATAGGTTGCTGCTCACCCAGGGCATTCCTGCCTGGTGTTTCAACCCATCAGCATTCCACTGCACTTGT
GGCTCCACCTTCCATCTCTCCATCCTTCAGCTCCAAGAGCCTGAAATCAAGCTCCCTCTTCGGAGAACCATTACGACAAG
TGCCAAGATCATCACTCAAGGTTTCAAAAACAAAACAGTCTTCCCTTGTCACCAGATGTGCAATTGGTGAGAGTCTGGAA
GTGTTCCTTGCAAAGGCAACCCCAGATAAGGGACTGATTAGGTTGCTGATAAGTATGGGAGAAGCATTAAGGACTATTTC
CTTCAAGGTGAGAACAGCTTCCTGTGGAGGAACGGCATGTATTAATTCCTTTGGGGATGAGCAGCTCGCGGTGGACATGC
TTGCTGACAAGCTTTTATTCGAGGCTTTAAGCTACTCACATTTCTGCAAATATGCTTGCTCTGAAGAGGTTCCAGAACTC
CAAGACATGGGAGGCCCAGTTGAAGGTGGATTTAGTGTTGCTTTTGATCCACTCGACGGCTCCAGCATTGTTGACACAAA
CTTCACTGTAGGCACTATCTTTGGTGTGTGGCCAGGAGATAAGTTAACTGGGATAACAGGGAGAGACCAAGTTGCTGCAG
CCATGGGAATTTATGGTCCTAGGACTACATATGTTCTTGCTATCAAGGGCTTCCCTGGAACCCACGAATTTCTTCTTCTA
GATGAAGGAAAATGGCAACATGTCAAGGAGACAACAGAGATTGGTGAAGGGAAATTATTCTCCCCAGGAAATTTGAGAGC
CACATTCGACAACCCAGACTATGACAAGTTGATCAACTACTATGTAAAAGAGAAATACACATTGAGATACACCGGAGGAA
TGGTGCCAGATGTCAATCAGATAATTGTAAAAGAGAAAGGAGTTTTCACAAATGTGATATCTCCAACTACCAAAGCCAAG
CTCAGGCTGTTATTTGAGGTAGCTCCATTGGGGTTATTAATCGAGAACGCTGGAGGTTATAGTAGTGATGGTCACCAGTC
TGTGTTAGACAAAGTGATCATTAATCTGGATGACAGAACACAAGTTGCGTATGGATCCAAAAATGAGATAATCCGGTTCG
AAGAAACTCTATACGGATCATCCAGGCTCAAGGCAGGTGTGCCTGTCGGAGCTGCAGCCTAA