Details for Peach Locus ppa006477m

Position : sca2 ( 5`- 21408493 .. 21412277 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa006477m

Protein [Map View]
MDSLPNGSATSPGPSPGPTAAAAPSSKLSHLSESLKLEHQFLRVPFEHYKKTIRANHRVVEREMSSVINGVSEAADSDDM
SSDDAVNHLSSLVSRLQGLKRKLEEGSRTEHLQAQRCRARLDHLESADVESLSDWNNTRLNRILVDYMLRMSYYDTAAKL
AESRNIQDLVDIDVFQEAKKVIEALQNKEVGPALAWCAENKSRLKKSKSKFEFQLRLQEFIELVRAENNLRAITYAQKYL
APWGTTHMKELQRVFVTVAYKSTTECATYKVLFEPKQWDYLVDQFKQEFCKLYGMTLEPLLNIYLQAGLSALKTPYCYDD
DCTKEDPLSQEGFRKLAQPLPYSKQHHSKLVCYITKELMDTENPPQVLPNGYVYSSKALEEMARKNDGKITCPRTGLVCN
YTDLVKAYIS*

DNA
ATGGATTCGCTTCCCAACGGCTCCGCCACGTCACCGGGCCCAAGCCCAGGCCCGACCGCCGCGGCCGCTCCGTCATCGAA
GCTGAGCCACCTGTCGGAGTCCCTGAAGCTCGAGCACCAGTTCCTCAGAGTCCCCTTCGAGCACTACAAGAAGACGATCC
GAGCCAACCACCGCGTTGTCGAGAGGGAGATGTCCTCCGTTATTAACGGCGTCTCCGAAGCCGCCGACAGCGACGACATG
TCTTCTGACGACGCCGTTAATCATCTTAGTTCTCTTGTCTCCAGGTTGCAAGGGCTCAAACGAAAGTTGGAGGAAGGGAG
TAGGACAGAGCACTTGCAGGCGCAAAGGTGCCGGGCTCGGCTTGACCATTTAGAATCGGCAGATGTGGAGAGTTTGTCTG
ATTGGAATAACACACGCTTGAATCGGATCCTAGTGGACTACATGTTGCGGATGTCTTATTATGACACTGCAGCAAAACTG
GCGGAAAGCAGAAATATTCAGGATCTTGTTGATATTGATGTATTCCAAGAAGCAAAAAAGGTTATAGAAGCTCTTCAGAA
TAAGGAGGTAGGTCCTGCCCTAGCCTGGTGTGCCGAGAACAAGTCAAGGTTGAAGAAATCCAAGAGCAAATTCGAGTTTC
AGCTGCGACTTCAAGAGTTTATAGAGTTGGTTCGAGCTGAAAATAACTTGCGAGCTATCACATATGCTCAGAAATACCTT
GCACCATGGGGAACTACTCACATGAAAGAATTGCAGCGGGTCTTTGTAACAGTAGCTTATAAGAGTACTACTGAATGTGC
TACATACAAGGTGTTATTTGAGCCGAAGCAATGGGACTACCTGGTTGACCAATTCAAACAGGAATTTTGCAAGTTATATG
GCATGACTCTTGAGCCTTTGCTGAATATTTATCTGCAAGCAGGCCTGTCTGCTCTGAAAACCCCATACTGTTACGACGAT
GATTGCACCAAGGAGGATCCACTATCACAGGAGGGTTTCCGGAAACTAGCCCAGCCATTACCGTATTCTAAGCAGCATCA
CTCGAAGCTTGTTTGCTACATAACTAAGGAACTAATGGACACAGAGAACCCGCCACAAGTCTTGCCCAATGGCTATGTCT
ACAGCTCTAAGGCTCTTGAAGAAATGGCCAGGAAAAATGACGGTAAGATTACTTGTCCAAGGACAGGTTTGGTCTGCAAT
TATACAGATCTGGTGAAGGCATATATATCATAA