Details for Peach Locus ppa006470m

Position : sca2 ( 5`- 23742746 .. 23744744 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa006470m

Protein [Map View]
MSSTVSTSRGIHSPARLGTYESPDAGASGSFSQLEPDINDGETELLSVSWNQDYGCFSAGTSNGFRIFNCEPFKETFRRD
LKSGGFKIVEMLFRCNILVLVGSGDNSQYPPNKVMIWDDHQSRCIGEFSFRSEVRSVRLRRDRIVVVLEHKIYVYNFMDL
KLLHQIETVANPRGLCCLSHHPNTSVLACPGLQRGQVRIEHFGLNMTKLINAHDSHIACFTLTMDGLLLATASTKGTLIR
IFNTMDGTRLQEVRRGVDRAEIYSIALSPNVQWLAASSDKGTVHIFSLRVRVFGEDLSAHSNSAQGPAMFQQNSSNALDP
LISQNTGANSSSSLAFMRGVLPKYFSSEWSFAQFHLPEDTQFITAFGSQNTVIVVGLDGSFYRCSFDPVHGGEMLQQEYV
RFLKTDSRPR*

DNA
ATGAGTTCAACAGTTTCAACATCTCGAGGAATACATTCGCCCGCAAGGCTTGGCACATATGAATCGCCAGATGCTGGGGC
GTCTGGCTCTTTTAGCCAGCTTGAACCAGACATCAATGACGGTGAAACAGAGTTACTCTCTGTATCCTGGAATCAGGACT
ATGGTTGCTTTTCTGCAGGCACAAGCAACGGTTTTCGTATCTTTAACTGCGAGCCTTTCAAGGAAACTTTTAGACGTGAT
TTGAAAAGTGGGGGATTCAAAATTGTGGAGATGCTGTTTCGATGCAACATTCTCGTACTTGTTGGAAGTGGAGACAATTC
CCAATATCCACCTAACAAGGTTATGATTTGGGATGATCATCAGAGCCGATGTATTGGTGAATTTTCATTCAGGTCTGAGG
TTCGTTCAGTAAGATTAAGGCGTGATCGCATAGTTGTTGTTCTTGAGCACAAGATATACGTTTACAACTTTATGGATCTG
AAGCTGCTGCATCAGATTGAGACTGTAGCAAATCCTAGAGGATTGTGCTGCCTTTCACATCATCCAAATACATCTGTGCT
GGCTTGCCCAGGCCTTCAACGAGGACAAGTTCGGATTGAACATTTTGGACTGAACATGACAAAGTTAATAAATGCTCATG
ATTCTCATATTGCATGCTTCACGTTAACAATGGATGGACTGCTTCTTGCTACTGCTAGTACAAAGGGTACTTTGATAAGA
ATCTTCAACACAATGGATGGGACTCGCTTACAAGAGGTACGCAGAGGAGTGGACAGAGCAGAAATTTACAGTATTGCTCT
CTCTCCGAACGTCCAGTGGTTGGCAGCATCGAGTGACAAAGGTACTGTCCATATATTCAGCCTCAGAGTTAGAGTATTTG
GGGAGGATTTGTCTGCCCATTCAAATTCTGCTCAAGGGCCAGCAATGTTTCAGCAGAATTCGTCAAATGCCCTAGATCCT
CTTATTTCTCAAAACACTGGTGCTAATTCTAGTTCATCACTGGCTTTCATGAGAGGGGTTTTACCTAAATATTTTAGCTC
AGAATGGTCATTTGCTCAGTTCCACTTGCCAGAAGACACTCAATTCATTACCGCATTTGGTTCACAGAACACAGTCATCG
TTGTTGGCTTGGATGGGAGTTTCTACAGGTGCAGTTTTGATCCAGTTCATGGAGGTGAGATGTTGCAGCAGGAATACGTA
CGGTTTCTGAAAACTGACAGTAGGCCAAGATAG