Details for Peach Locus ppa005871m

Position : sca2 ( 5`- 22658541 .. 22660886 -3` )
Annotation : [B2G] proline transporter
External links : CoGe
PGDD synteny : ppa005871m

Protein [Map View]
MDATSEVYSGSRKLHEEETAEIPETAHQISTDSWFQVGFVLTTGINSAYVLGYSGNVMIPLGWIGGVIGLILATAISLYA
NALIAKLHEYGGVRHIRYRDLAGFIYGKKAYSLTWGLQYVNLFMINTGFIILAGQALKAAYVLFKDDHAMKLPHFIAISG
VVCAIFAIGIPHLSALRIWLGFSTVFSLIYIVIAFVLSLQDGLEAPARSYDIPGTKISRIFTTIGAAASLVFAFNTGMLP
EIQATVRKPVVENMMKALYFQFTAGVVPLYAVCFVGYWAYGNKTSSYLLNNVNGPIWVKAMANIAAFLQTVIALHIFASP
MYEYLDTKFGIKGSPLKIQNLTFRITVRGGYLAINTLVSALLPFLGDFMSLTGAISTFPLTFILANHMYLVAKKDTLTSA
QKLWHWLNVGFFALLAVAALISALRLIAVDSKTYHVFADL*

DNA
ATGGATGCTACTAGTGAAGTCTATTCTGGTTCTAGAAAGCTTCATGAGGAAGAAACTGCCGAAATCCCAGAAACCGCCCA
TCAGATTAGCACAGATTCATGGTTTCAAGTGGGATTTGTCCTCACCACCGGTATCAACAGTGCGTATGTGCTGGGATACT
CTGGAAATGTAATGATTCCTCTGGGTTGGATAGGCGGTGTAATCGGTCTAATTCTAGCCACTGCAATATCACTCTATGCA
AACGCTCTTATTGCTAAGCTCCATGAATATGGTGGGGTTAGGCACATCAGATACAGAGATCTTGCAGGATTTATATATGG
CAAGAAAGCTTATTCACTTACATGGGGATTGCAATATGTCAATCTTTTCATGATTAACACGGGATTTATCATTTTGGCTG
GTCAGGCCCTCAAGGCTGCGTATGTTCTGTTCAAGGATGACCACGCCATGAAGCTTCCGCATTTTATTGCCATTTCTGGC
GTTGTTTGTGCAATATTTGCTATAGGGATACCACACTTGTCAGCTCTCAGGATTTGGCTGGGGTTTTCAACAGTCTTCAG
CTTGATATATATTGTTATAGCATTCGTCTTGTCACTTCAAGATGGACTTGAAGCACCGGCCAGGAGTTATGACATCCCGG
GGACAAAAATAAGCAGAATATTTACCACAATCGGAGCGGCTGCTAGCCTGGTCTTTGCATTCAACACAGGAATGCTACCA
GAGATACAGGCTACAGTGAGGAAGCCAGTTGTTGAAAACATGATGAAGGCTCTGTACTTTCAGTTTACAGCTGGAGTTGT
GCCACTGTATGCCGTTTGTTTTGTAGGGTATTGGGCATATGGAAATAAAACATCATCTTATTTGCTCAACAATGTCAACG
GGCCGATTTGGGTGAAGGCAATGGCCAATATTGCTGCCTTCCTGCAAACAGTCATTGCTTTGCATATATTTGCAAGTCCA
ATGTATGAGTATCTGGACACAAAGTTTGGTATTAAAGGAAGTCCACTGAAAATTCAGAACTTAACATTCAGAATTACTGT
TAGAGGTGGCTACTTAGCCATTAACACACTGGTTTCAGCCCTTCTGCCATTCCTTGGAGATTTCATGAGCCTCACGGGAG
CCATCAGCACATTCCCTCTCACATTTATTCTTGCAAACCACATGTACCTGGTGGCAAAGAAGGACACACTCACTTCCGCG
CAAAAGCTCTGGCATTGGCTAAATGTTGGTTTCTTTGCCCTTTTGGCCGTTGCAGCTTTAATCTCAGCCTTGAGGCTCAT
AGCAGTAGATTCTAAAACTTACCATGTATTTGCTGATCTATGA