Details for Peach Locus ppa005684m

Position : sca2 ( 5`- 23392513 .. 23394543 -3` )
Annotation : [B2G] amino acid
External links : CoGe
PGDD synteny : ppa005684m

Protein [Map View]
MVKQENGDEAEAVAHPLLQDLKSLEGQNSSSSEKGASFSGAVFNISTTMIGAGIMSIPATIKVLGIVPGFILILLVALVV
EVTVEFLLRYTNSGESSTYAGMVGESFGPWGSIAVQICVIITNLGCLIIYFIIIGDVLCGSQSGGTLHFGILQEWFGVHW
WNSRAYALLFIALFVMLPLVLSRRVDSLRHTSAVSILLAVVFVVICSAMAIYALCKGKTQKPRLFPDCAHQVSVFDLFTT
IPILVTGFGFHVNVHPIRAELGKPSDMRSAARISLVISIIIYFSIGFFGYLLFGDSVMDDILVNFDQSSDSTIGQIINDT
VRLSYAVHLLFVFPIMNFSLRANIDELLFPNKPILAQSTSRFLSLTFVLLSFTYIVAIAIPSIWYFFQFMGSTTIVCLSF
IFPAALILRDGHGISTRRDKIIAILVIILAVVTSSIAMSTTLYNSAQS*

DNA
ATGGTGAAGCAGGAAAACGGTGATGAGGCTGAAGCGGTTGCTCATCCACTCTTGCAGGACCTCAAGTCCTTGGAAGGTCA
AAATTCATCATCATCAGAAAAAGGCGCTTCATTTTCTGGGGCTGTCTTCAACATCTCAACCACAATGATTGGAGCTGGGA
TCATGTCAATTCCAGCAACCATCAAGGTCCTAGGCATAGTTCCTGGGTTCATTCTCATATTGTTGGTGGCCTTGGTTGTG
GAGGTCACAGTGGAGTTCTTGCTCAGGTACACAAACTCAGGCGAGTCTTCTACCTATGCTGGCATGGTGGGTGAGTCTTT
TGGACCCTGGGGTTCCATTGCTGTGCAAATTTGTGTCATCATCACCAATCTTGGCTGCCTCATCATTTATTTCATTATCA
TTGGGGATGTTCTATGTGGAAGTCAGTCTGGAGGAACCTTGCACTTTGGTATTTTACAAGAATGGTTTGGCGTCCACTGG
TGGAATTCTCGTGCTTATGCGCTTCTCTTTATTGCACTCTTTGTGATGCTTCCATTAGTCTTGTCTCGCCGAGTAGATTC
ACTAAGGCACACTTCAGCAGTGTCCATTCTGCTAGCAGTGGTTTTTGTTGTCATATGCTCTGCAATGGCAATTTACGCAT
TGTGCAAAGGGAAGACTCAGAAACCGAGACTATTTCCGGATTGTGCACATCAAGTCTCAGTATTTGATCTTTTCACCACC
ATCCCAATTCTTGTGACAGGTTTTGGATTCCATGTCAATGTTCATCCAATTCGAGCAGAGCTTGGTAAACCTTCTGATAT
GAGATCAGCTGCTCGGATTTCTCTTGTGATCAGCATCATCATTTACTTTTCTATTGGTTTCTTTGGCTACCTATTGTTTG
GCGATTCGGTAATGGATGACATACTAGTAAACTTTGATCAAAGTTCTGATTCCACAATTGGGCAGATAATCAATGACACT
GTTCGACTGAGCTATGCAGTTCACCTCTTGTTTGTGTTTCCTATTATGAACTTTTCCTTAAGGGCCAACATAGATGAACT
GCTTTTCCCAAATAAGCCTATTTTGGCCCAAAGCACCTCAAGATTTCTGTCCCTCACTTTTGTGCTGCTCTCCTTTACAT
ACATTGTGGCAATAGCTATCCCAAGCATATGGTACTTCTTTCAGTTCATGGGATCCACTACCATAGTTTGCCTCTCATTT
ATATTCCCAGCTGCTCTCATTCTTAGGGATGGGCATGGTATATCAACAAGAAGGGACAAGATAATTGCAATATTGGTGAT
TATTTTGGCTGTGGTGACAAGCTCAATTGCAATGTCTACCACTCTGTACAATTCAGCTCAAAGCTAG