Details for Peach Locus ppa005384m

Position : sca2 ( 5`- 22443925 .. 22448601 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa005384m

Protein [Map View]
MEEEKEKVVFMWGYLPGALPQRSPLLSPTIVRTPGAEYTYKDVCGGGCGFAMALSESGKIITWGSTDDLGQSYVTSGKHG
ENPEPFPLPTDASIGKAAAGWAHCVAVTDIGGVYTWGWKECVPSGKFLGEQPMGANVEKDAIERQSSYLNEQVSPRSQGS
QSTGGAFSVEESTKRRRLSSAKQAAESSSSGDEPLSALPCLVTLNPGVRIATVAAGGRHTLALSDIGQVWGWGYGGEGQL
GLGSRIRMVSSPHPVPCIEPSSYGKDRSAALPRGTMGSEGLGLRVPGNYVKGIACGGRHSAVITDAGAVLTFGWGLYGQC
GQGSTDDELSPACVSSLLGIRIEGVAAGLWHTVCISADGDVYAFGGNQFGQLGTGADQAETIPRLLDAPSLENTNAKIVS
CGARHSTIITDDDKVFGWGWNKYGQLGLGDVIDRNIPAQVTIDGCVPKNVACGWWHTLLLAEPT*

DNA
ATGGAAGAGGAGAAAGAGAAGGTGGTGTTCATGTGGGGCTATCTTCCTGGAGCTCTACCGCAAAGGTCGCCTCTTTTGTC
GCCGACCATCGTGCGGACGCCCGGCGCCGAGTACACGTATAAGGATGTGTGTGGAGGCGGTTGCGGCTTCGCCATGGCGC
TTTCTGAGTCTGGAAAGATTATTACATGGGGTTCAACAGATGATCTAGGTCAAAGCTATGTGACATCTGGGAAGCATGGG
GAAAATCCGGAGCCTTTTCCTCTTCCAACTGATGCTTCTATAGGAAAAGCTGCCGCAGGTTGGGCTCATTGTGTTGCAGT
CACAGATATTGGAGGAGTTTACACATGGGGATGGAAAGAGTGTGTTCCGTCTGGAAAGTTTCTTGGAGAGCAACCTATGG
GGGCAAACGTTGAAAAGGATGCAATTGAAAGGCAGAGTTCTTATTTGAACGAGCAAGTTAGCCCTCGCTCTCAAGGCTCA
CAATCCACTGGCGGGGCATTTTCTGTTGAAGAAAGTACAAAGCGACGAAGATTATCTTCGGCAAAGCAAGCGGCTGAAAG
TTCATCATCTGGTGATGAACCTCTCTCAGCATTGCCATGCCTTGTGACATTGAACCCAGGAGTTAGAATAGCTACAGTTG
CTGCTGGAGGGCGCCATACTCTGGCATTATCAGATATAGGACAAGTGTGGGGATGGGGCTATGGAGGTGAAGGGCAGCTT
GGTCTGGGCTCCCGGATACGTATGGTGTCCTCTCCTCATCCTGTACCTTGCATTGAGCCCTCTTCTTATGGAAAAGATAG
ATCTGCAGCACTGCCTCGAGGAACCATGGGTTCAGAGGGACTCGGTCTTCGAGTTCCTGGTAATTATGTGAAAGGGATCG
CATGTGGAGGGCGACATAGTGCAGTAATCACAGATGCTGGAGCAGTACTTACTTTTGGTTGGGGGCTGTATGGACAGTGT
GGGCAAGGAAGTACAGATGATGAATTAAGCCCGGCTTGTGTATCTTCACTACTGGGTATCCGGATAGAGGGTGTTGCTGC
AGGACTGTGGCACACTGTCTGCATTTCAGCTGATGGTGATGTTTATGCATTTGGCGGGAATCAGTTTGGACAGCTGGGAA
CTGGAGCTGATCAAGCTGAGACTATACCAAGACTTTTGGATGCTCCAAGTCTGGAAAATACAAATGCAAAGATTGTTTCC
TGTGGAGCACGTCATAGTACCATAATCACAGACGATGATAAAGTTTTCGGCTGGGGATGGAACAAGTACGGTCAGCTTGG
CTTGGGTGATGTGATCGACCGCAACATTCCGGCTCAAGTCACAATTGATGGATGTGTGCCAAAAAATGTGGCATGTGGCT
GGTGGCATACCTTACTACTTGCTGAACCCACTTGA