Details for Peach Locus ppa005326m

Position : sca2 ( 5`- 20969664 .. 20972692 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa005326m

Protein [Map View]
MTSTRSEMQEPSIDTDKLSYEIFSILESKFLFGYDDQKLWVPKQVSPSPPPSDPKLETQPQSETPVSAIKNQRGKICILS
IDGGGGMRGILSGKALAYLEHALKLKSGNPEARIADYFDVAAGAGVGGIFAAMLFASRDQARPMFKADDTWRFLADHGKS
FFNNRSSSASSGGFLRRFIRGSGSGSGLSATAGLDKAMKEAFADNDRTLTLKDTLKPVLIPCYDLSSTAPFLFSRADALE
TDSYDFRLWEVCRATSAEPGVFEPVQMRSVNNQTRCLAVDGGLAMSNPAASAITHVLHNKQEFPFVRGVEDIMVLSIGTG
QFLEEARYEYEQVKRWRAKEWARPMAKIAGDGSADLVDQSVAMAFGQCGSSNYVRIQANGTSLGRCGPNVDTDPSPNNVK
MLVGAAEEMLKQKNVESVLFGGKRIGEQSNFEKLDWFAGELVLEHQRRSCRIAPTVAFKQAAAKTT*

DNA
ATGACTTCGACTCGGTCCGAAATGCAAGAGCCGAGCATCGACACCGATAAGCTCAGCTACGAGATATTCTCCATATTGGA
GAGCAAGTTCCTCTTCGGCTACGACGATCAGAAACTCTGGGTCCCCAAGCAGGTCTCTCCGTCTCCGCCCCCCTCCGACC
CCAAACTCGAAACCCAGCCCCAATCCGAAACCCCCGTTTCGGCAATCAAGAACCAGAGGGGCAAAATCTGCATACTCAGC
ATCGACGGCGGCGGAGGCATGCGGGGGATTCTCTCTGGCAAGGCCCTCGCGTATCTCGAGCACGCGCTCAAGCTCAAATC
GGGCAATCCCGAAGCCAGAATCGCCGATTACTTCGACGTTGCCGCCGGCGCCGGCGTCGGAGGCATCTTTGCCGCCATGC
TCTTCGCCAGCAGAGACCAGGCCCGGCCTATGTTCAAGGCCGACGACACGTGGCGCTTCCTCGCTGATCACGGCAAGAGC
TTCTTCAACAACCGCTCCTCCTCCGCTAGTTCGGGCGGGTTCCTCCGCCGTTTCATCCGAGGTTCTGGTTCGGGTTCCGG
TTTGAGCGCCACGGCCGGTTTGGACAAAGCGATGAAAGAGGCCTTCGCCGATAACGATCGAACCCTGACTCTAAAAGACA
CGCTCAAGCCGGTTTTAATTCCCTGCTACGACCTCTCCAGTACGGCGCCGTTTTTGTTCTCCCGCGCCGACGCGCTCGAA
ACCGACAGCTACGACTTCCGCCTCTGGGAGGTCTGCCGCGCCACGTCAGCCGAGCCGGGAGTCTTCGAACCGGTTCAAAT
GCGGTCGGTCAACAACCAGACCCGGTGCCTCGCCGTGGACGGCGGATTGGCCATGAGCAACCCGGCGGCTTCGGCGATTA
CGCACGTGCTGCACAACAAGCAGGAGTTTCCGTTCGTGCGAGGGGTCGAGGACATAATGGTCCTTTCAATAGGGACCGGC
CAGTTTCTAGAAGAAGCAAGGTACGAGTACGAGCAGGTGAAGAGGTGGAGGGCAAAGGAATGGGCTCGGCCCATGGCCAA
AATTGCCGGCGACGGGTCAGCGGACCTGGTGGACCAGTCCGTCGCCATGGCGTTTGGTCAGTGCGGAAGCAGTAACTACG
TGCGCATTCAGGCAAATGGGACTAGCTTGGGACGGTGCGGGCCAAATGTAGATACAGACCCAAGTCCCAACAACGTGAAG
ATGCTGGTAGGAGCGGCAGAGGAAATGCTGAAACAGAAGAATGTTGAATCAGTACTCTTTGGTGGTAAGAGAATTGGTGA
GCAGAGCAATTTCGAGAAGCTCGATTGGTTTGCCGGAGAACTGGTTTTGGAGCATCAGAGGAGGAGTTGCAGAATAGCTC
CCACTGTTGCCTTCAAGCAAGCTGCTGCCAAAACCACTTAG