Details for Peach Locus ppa004978m

Position : sca2 ( 5`- 22793376 .. 22791925 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa004978m

Protein [Map View]
MVDLDWKAKMVSSDIPSKSPKLSNKLHVSIPGSFRAAQVQTDISEASEMACSTYEHYLRLPELRNLWSSNDFPCWRNESV
LKPSLQALEISFRFISTVLSDPRPYSNRREWKRRLESLTTGQIQLIAMLIEDDEEDSETRGAAPIVDLSTSYGELARNGS
SAEVWSSGETTVVSRTSEASLLPRLATWQKSEGMAQKILYSIECEMRSCPYTLGLGEPNLAGKPNLDYDAVCRPSELHSL
KKSPYDHIDNYENQTVYTTHQVLESWVFVCQELLKRVTRRIEARDFEKAASDCYLIERIWKLLAEIEDLHLLMDPDDFLR
LKNQLSIKTVDDTESFCFRSKGLVDVTKLCKELRHRVPYILDVEVDPKGGPRIQEAAMRLYSEKKIGSDSDSEKIHVLQA
LQAIESALKRFYYAYKQVLVVLMGSLEAKGNRVVVSTEICDSLSQIFLEPTYFPSLDAAKTFLGDSLNHEHGGGGVRRSR
RKQ*

DNA
ATGGTTGATTTAGATTGGAAAGCCAAGATGGTCTCCTCTGACATACCCAGTAAATCCCCAAAGCTCTCCAACAAGCTCCA
CGTTTCGATACCCGGTTCGTTTCGCGCCGCACAAGTCCAAACTGATATTTCGGAGGCTTCCGAAATGGCTTGCTCCACTT
ACGAGCACTACCTTCGCCTCCCGGAGCTCCGAAACCTCTGGAGCTCCAACGACTTCCCCTGCTGGAGAAACGAGTCCGTT
CTAAAACCGTCCCTGCAAGCTCTCGAAATTTCGTTCCGGTTCATCTCGACCGTTTTGTCCGACCCGAGGCCGTACTCGAA
CCGGCGCGAGTGGAAGCGCCGGCTGGAGTCGCTCACCACCGGCCAGATACAACTCATCGCGATGCTGATCGAGGACGACG
AAGAAGACAGCGAGACACGTGGAGCCGCTCCCATCGTCGATCTGAGCACGTCGTACGGCGAGCTCGCTCGGAACGGGAGC
TCAGCCGAGGTGTGGAGTTCGGGTGAGACGACGGTAGTGAGCCGCACCAGCGAGGCCAGCTTGCTTCCGCGGCTCGCCAC
GTGGCAGAAATCAGAAGGCATGGCGCAGAAGATCTTGTACTCGATCGAATGCGAGATGAGGAGCTGTCCGTACACGCTAG
GTTTGGGAGAGCCGAACCTAGCCGGAAAGCCGAACCTGGATTACGACGCCGTTTGCAGGCCGAGCGAGCTGCATTCGCTG
AAGAAGAGCCCGTACGATCACATCGACAACTACGAGAACCAGACGGTGTACACCACGCACCAGGTCCTCGAGTCGTGGGT
GTTCGTTTGCCAGGAGCTTCTCAAGCGAGTCACGCGCCGAATCGAGGCGAGAGACTTCGAAAAAGCCGCTAGTGACTGTT
ACCTGATCGAACGGATATGGAAGCTTCTGGCGGAGATCGAAGATCTCCACCTTCTGATGGACCCGGACGATTTTCTGAGG
CTGAAGAACCAGCTCAGCATCAAGACGGTGGACGATACGGAGTCGTTTTGCTTCAGATCGAAGGGGCTGGTGGACGTGAC
GAAGCTTTGTAAGGAGTTGAGGCACAGGGTGCCGTACATCTTGGATGTTGAGGTGGACCCCAAGGGTGGGCCCAGGATTC
AGGAGGCGGCGATGAGGTTGTATTCGGAGAAGAAGATCGGATCGGATTCGGACTCGGAGAAGATCCACGTGCTGCAGGCG
CTTCAGGCGATTGAGTCGGCGCTGAAGCGGTTCTACTACGCGTACAAACAGGTGCTGGTGGTTTTGATGGGTAGCTTGGA
AGCGAAGGGAAACCGAGTCGTGGTGAGTACGGAGATATGTGACTCACTGAGTCAGATATTCTTGGAGCCGACTTATTTTC
CGAGTTTGGACGCGGCAAAGACGTTTTTGGGCGACAGTTTGAATCACGAACATGGAGGAGGAGGAGTCAGACGGAGTCGG
AGGAAACAGTGA