Details for Peach Locus ppa004567m

Position : sca5 ( 5`- 18122787 .. 18119776 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa004567m

Protein [Map View]
MVISTTSSERGGQVNSTFASRYVRNALPKFEMPETSIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDQLIMASL
NKNYVDMDEYPVTTELQNRCVNIIANLFNAPLGDGETAVGVGTVGSSEAMMLAGLAFKRKWQQKRKAEGKPYDKPNMVTG
SNVQVCWEKFARYFEVDLKEVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLTQKNKEKGWDTP
IHVDAASGGFIAPFLYPDLVWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDELVFHINYLGSDQPTFTLNFSK
GSSQIIAQYYQFIRLGFEGYKNVMENCMENTRFLREGLEKTGRFEIVSKDIGVPLVAFSLKDSSKHTVFEISDSLRKFGW
IVPAYTMPANAEHIAVLRVVVREDFSRGLAERLISDIIKVVKETDTLPSRISTKTAHVTATVDEMARSSEGAVKPAKKSV
EEIEQEITRRWKGLVDGKKRGVC*

DNA
ATGGTGATCTCAACGACGAGCAGCGAGCGTGGAGGGCAGGTGAACTCTACGTTTGCATCGAGATATGTGCGTAACGCCCT
CCCTAAGTTCGAGATGCCGGAGACGTCGATACCCAAGGACGCAGCGTATCAGATAATAAAGGATGAGCTAATGCTGGATG
GGAACCCCAGGCTCAACTTGGCATCATTTGTCACGACGTGGATGGAGCCAGAGTGCGATCAGCTCATCATGGCCTCCCTC
AACAAAAACTACGTCGACATGGATGAGTACCCTGTTACCACTGAACTCCAGAATCGTTGTGTGAATATAATAGCAAACCT
TTTTAATGCTCCCCTTGGAGACGGCGAAACTGCTGTTGGAGTGGGAACTGTTGGTTCTTCAGAGGCAATGATGTTGGCAG
GCCTAGCTTTTAAACGAAAGTGGCAGCAAAAGAGAAAAGCAGAGGGCAAGCCTTACGATAAGCCCAACATGGTCACCGGA
TCCAATGTGCAGGTATGCTGGGAAAAGTTTGCGAGGTATTTTGAGGTTGATCTCAAGGAGGTGAAGCTGTCAGAGGGATA
CTATGTAATGGACCCTGTGAAAGCAGTTGAGATGGTGGATGAGAACACTATCTGTGTTGCAGCTATTTTAGGATCAACTC
TGACGGGAGAATTTGAAGATGTGAAGCTCCTCAATGATCTCCTTACTCAAAAGAACAAAGAGAAGGGCTGGGATACTCCC
ATTCATGTGGATGCTGCGAGCGGAGGCTTTATAGCTCCATTTCTTTATCCTGATCTTGTGTGGGATTTCCGTTTGCCCTT
AGTCAAGAGTATCAATGTAAGTGGCCACAAGTATGGCCTTGTATATGCTGGTGTTGGCTGGGTTGTATGGAGGAGCAAAG
AGGACTTGCCGGACGAGCTTGTCTTTCACATCAATTACCTTGGATCTGACCAGCCCACTTTCACCCTTAACTTTTCTAAA
GGTTCTAGCCAAATAATTGCTCAGTATTATCAGTTTATTCGACTGGGTTTTGAGGGTTACAAAAATGTCATGGAAAACTG
CATGGAGAACACAAGATTTCTGAGAGAAGGATTAGAGAAAACAGGGCGGTTTGAAATTGTCTCCAAAGACATAGGAGTGC
CCCTTGTGGCATTTTCTCTAAAAGACAGCAGCAAGCACACCGTGTTCGAGATATCGGATAGTTTGAGAAAGTTTGGGTGG
ATAGTTCCAGCCTATACGATGCCAGCCAATGCAGAACATATTGCTGTTCTGCGAGTGGTTGTTAGGGAGGATTTTAGCCG
GGGTTTGGCTGAGAGGCTTATCTCGGACATTATCAAAGTTGTGAAGGAAACAGACACACTCCCAAGCCGAATCTCTACGA
AAACCGCCCATGTCACAGCTACTGTTGATGAAATGGCCCGTAGCAGTGAGGGGGCGGTGAAGCCTGCTAAGAAGAGTGTA
GAAGAGATCGAACAAGAGATTACAAGGCGTTGGAAGGGGCTTGTGGATGGCAAGAAAAGAGGCGTATGCTAA