Details for Peach Locus ppa004451m

Position : sca3 ( 5`- 19608011 .. 19604979 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa004451m

Protein [Map View]
MSEAKDPAIKLFGKTIPVPEVPLSSGESVGAPEPDPSSGTLVEDTVDQDHASSSNSSPEVNTNRDREEKEVNNHKDTSGE
KPMQTKQEDGIPPLSSEEVTNPDTASRVGVNPKSPVEKENATVKNLKTEEEQSETSNSQEKTLKKPDKILPCPRCNSMDT
KFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSASHYRHITVSEAMPNAQTDVLNGVHHPSVKSNGTV
LTFCGDAPLCESMASVLHLADKNIQNGTHNGFQKPEGLRIPASYGSGVNGDDHSNRSTVTDSNSKDEACKTGSQEQVMQS
YQGFPPQIPCFPGAPWPYPWNSAQWSSPVTPPAFCPPGFPMPYYPAAAYWGCAVQGAWNIPWLPPPSSPNHSAPSSGPNS
PTLGKHSRDESTVKQNNSEEEEAPKEKSAERCLWIPKTLRIDDPGEAARSSIWATLGIKNDKADSLSGGGLFKAFQPKGD
KKNHLTEASPVLQANPAALSRSLNFQESS*

DNA
ATGTCGGAGGCAAAGGACCCAGCGATCAAGCTTTTCGGGAAGACGATTCCGGTGCCGGAGGTCCCTTTAAGCTCCGGCGA
ATCGGTCGGAGCTCCTGAACCGGATCCATCTTCTGGAACCCTCGTTGAAGATACTGTCGATCAGGACCATGCCTCTTCCT
CCAACTCTTCGCCTGAAGTCAATACCAACAGAGACAGGGAAGAGAAAGAGGTCAATAATCATAAGGACACTTCGGGAGAA
AAACCAATGCAGACTAAACAGGAAGATGGAATCCCGCCTTTATCTTCGGAAGAGGTGACAAATCCAGATACAGCATCGAG
AGTAGGTGTGAACCCTAAATCACCTGTTGAGAAGGAGAATGCTACAGTAAAAAATTTGAAGACTGAAGAAGAACAGAGTG
AGACAAGTAATTCACAAGAAAAGACCCTGAAGAAACCAGATAAAATACTTCCATGCCCCCGCTGTAATAGCATGGATACC
AAGTTCTGTTACTACAATAATTACAACGTCAACCAACCCCGGCACTTCTGCAAGAACTGCCAGAGATATTGGACAGCTGG
TGGGACCATGAGGAATGTGCCTGTGGGTGCAGGACGTCGGAAGAATAAGAATTCTGCTTCTCACTATCGCCACATAACTG
TCTCTGAAGCAATGCCGAATGCTCAAACTGATGTTCTGAATGGAGTTCACCATCCTTCAGTAAAATCTAATGGTACTGTC
CTAACATTTTGCGGGGATGCGCCCCTTTGCGAATCAATGGCTTCTGTCCTTCACCTTGCTGATAAAAATATACAGAACGG
TACACATAATGGATTTCAGAAACCTGAAGGATTAAGGATTCCAGCTTCTTATGGAAGTGGAGTAAATGGAGATGATCATT
CGAATAGATCTACAGTGACAGATTCAAATTCAAAGGATGAGGCATGCAAAACTGGGTCACAAGAGCAGGTTATGCAGAGT
TATCAGGGCTTCCCACCTCAAATACCATGCTTTCCTGGGGCGCCTTGGCCGTACCCCTGGAACTCTGCCCAATGGAGCTC
TCCAGTAACACCACCTGCTTTCTGCCCTCCAGGTTTTCCTATGCCCTATTACCCTGCAGCAGCTTATTGGGGTTGTGCTG
TGCAAGGCGCTTGGAATATCCCTTGGCTTCCACCGCCATCATCTCCAAACCACTCTGCTCCAAGTTCTGGTCCTAACTCT
CCGACCTTGGGAAAACATTCGAGGGATGAGAGCACTGTGAAACAAAATAACTCTGAGGAAGAGGAGGCACCAAAAGAAAA
GAGTGCTGAGAGATGCCTTTGGATTCCAAAGACATTGAGGATTGATGACCCGGGAGAAGCTGCAAGAAGCTCTATATGGG
CAACACTGGGGATTAAGAATGATAAGGCTGATTCACTTAGCGGTGGGGGACTCTTTAAGGCCTTCCAACCAAAGGGTGAT
AAAAAGAATCACCTGACTGAAGCTTCTCCGGTCTTACAAGCCAATCCAGCAGCATTATCTAGGTCACTCAATTTCCAAGA
GAGTTCATAA