Details for Peach Locus ppa003426m

Position : sca2 ( 5`- 22827771 .. 22832132 -3` )
Annotation : [B2G] anthranilate synthase alpha 1
External links : CoGe
PGDD synteny : ppa003426m

Protein [Map View]
MQAPCISRRLVPASHRLSPVPVIGISSRSSTSLACVPRTKCCSLSNQSLANDVKKFEEASKKGNLVPLSKCIFSDHLTPV
LAYRCLVKEDDREAPSFLFESVEQNNQGRYSVVGAQPTMEIVAKENKVTIMDHEERCLTEEVVEDPMAIPRRISETWSPQ
LIDDLPDAFCGGWVGYFSYDTVRYVERRRLPFSKAPKDDRNLPDMHLGLYDDVIVFDHVEKRVYAIHWVRLDRYSSVEKA
YTDGVRRLEKLVARVHDIDVPRLSPGSMNLHTRQFGPPLKNSNMTSEAYKNIVNHAKEHIVAGDIFQIVLSQRFERRTFA
DPFEVYRALRTVNPSPYLTYLQARGCILVASSPEILMSAKKKKIINRPLAGTCRRGKTTAEDQMLEEQLLDDEKQCAEHI
MLVDLGRNDVGKVCKFGSVKVDRLMEIERYSHVMHISSTVTGELQDDLTCWDALRAALPVGTVSGAPKVKAMELIDELEV
ARRGPYSGGFGAVSFSGDMDIALALRTMVFTTGSRFDTLYSYKDASQRREWVAHLQAGAGIVADSDPDDENQECQNKAAG
LARAIDLAEAAFVDQ*

DNA
ATGCAAGCCCCGTGCATCTCTCGGCGCTTGGTTCCGGCGAGCCACCGGCTGTCTCCGGTTCCGGTCATCGGCATTTCGAG
CAGAAGCTCAACTTCGCTTGCATGTGTCCCTAGAACGAAATGCTGCTCTCTCTCGAACCAGTCCTTAGCTAATGATGTAA
AGAAGTTTGAGGAAGCTTCAAAGAAGGGAAATTTGGTTCCCCTTTCCAAATGCATTTTTTCTGACCACCTCACTCCAGTT
CTGGCGTACCGATGCTTGGTTAAGGAAGACGATCGAGAGGCTCCAAGCTTTCTCTTTGAGTCAGTGGAGCAAAACAATCA
GGGGCGTTACAGTGTTGTTGGAGCTCAACCAACAATGGAAATCGTGGCGAAAGAAAATAAGGTGACGATAATGGATCATG
AAGAAAGATGTTTGACTGAGGAGGTTGTAGAGGATCCAATGGCTATTCCAAGAAGAATCTCAGAGACTTGGAGTCCCCAA
CTTATTGATGACCTTCCAGATGCATTTTGTGGTGGCTGGGTCGGTTACTTTTCGTATGATACAGTTCGGTATGTGGAAAG
AAGAAGGCTGCCATTCTCAAAGGCCCCCAAGGATGACAGAAATCTTCCAGACATGCATTTAGGGCTGTATGATGATGTAA
TAGTATTTGATCATGTGGAGAAGAGAGTTTATGCGATTCATTGGGTGAGGCTAGATCGGTACTCCTCAGTTGAGAAAGCT
TATACAGATGGAGTAAGACGTTTGGAGAAATTAGTGGCTAGAGTACACGACATTGACGTCCCAAGGCTATCTCCAGGTTC
CATGAATCTACATACTCGCCAATTTGGTCCTCCATTAAAGAACTCAAACATGACAAGCGAGGCTTACAAGAACATAGTAA
ATCATGCAAAAGAACATATAGTCGCAGGGGATATTTTCCAGATTGTATTAAGTCAACGATTTGAACGCCGAACATTTGCT
GACCCATTTGAAGTTTATAGAGCCTTGAGGACTGTAAATCCCAGTCCATATTTGACTTACTTGCAGGCTAGAGGGTGTAT
CCTGGTTGCTTCAAGTCCAGAAATTCTAATGAGTGCAAAAAAGAAAAAGATAATCAATCGGCCATTAGCTGGAACTTGTA
GAAGGGGGAAGACAACTGCAGAAGATCAAATGTTAGAAGAGCAGCTACTTGATGATGAAAAGCAATGTGCAGAGCACATC
ATGCTAGTTGATCTGGGTCGGAATGACGTTGGAAAGGTCTGCAAATTCGGCTCCGTGAAGGTAGATAGATTGATGGAAAT
TGAACGGTATTCCCATGTAATGCACATAAGCTCCACGGTTACGGGAGAGCTGCAAGATGATCTCACTTGTTGGGATGCCT
TGCGAGCTGCATTGCCTGTCGGAACTGTTAGTGGTGCACCAAAGGTGAAGGCCATGGAGTTGATTGATGAGCTGGAGGTA
GCAAGGCGTGGCCCGTACAGCGGTGGATTTGGAGCGGTTTCCTTTTCTGGTGATATGGACATTGCGCTAGCTCTAAGGAC
CATGGTGTTTACAACAGGATCCCGTTTCGACACATTGTACTCTTACAAAGATGCCAGCCAGCGCCGGGAATGGGTCGCTC
ATCTTCAAGCTGGTGCTGGTATTGTGGCTGACAGTGATCCCGATGACGAAAACCAAGAGTGCCAGAACAAAGCTGCTGGT
CTTGCTCGTGCCATCGACTTGGCTGAGGCAGCATTTGTTGATCAATGA