Details for Peach Locus ppa002415m

Position : sca2 ( 5`- 22992454 .. 22994481 -3` )
Annotation : [B2G] c3hl domain class transcription factor
External links : CoGe
PGDD synteny : ppa002415m

Protein [Map View]
MCKGSKDKLSPSNFTMESGFPKQNSVLVELSASDNLDAFRSEVQEKGFHVDEAGFWYGRRIGSKKMGFEERTPLMIAAMF
GSTKVLKYIIQSGKADVNRSCGSDKVTALHCATAGGSTASLEVVKLLLDASADANCVNANGNKPIDLIAPALKSPCSSRR
KTMEMLLKGDMSVMESDQIANQEGDQQKFPSPQLSKDGSEKKEYPIDISLPDINNGIYGTDEFRMYTFKVKPCSRAYSHD
WTECPFVHPGENARRRDPRKYPYSCVPCPEFRKGSCQKGDVCEYAHGVFESWLHPAQYRTRLCKDETGCTRKVCFFAHRP
EELRPVYASTGSAMPSPRSMSVSAADMASPLALGSSPMSQPTTSTPPMSPLATSSSPKNGALWQNKLNLTPPALQLPGSR
LKSALSARDLDLEMELLGLDSHSSQQQKHQHQQQQQQQLWDEISRLSSPKCYNNDFSRIGELKPTNLDDAFGSFDPSLLS
QLQGVSLKPSTPTQLQSSAHQIRQNMNQLRSSYPTNLSSSPVRKPSSFGLDSPGALAAAVMNSRSAAFAQRSHSFIDRGA
MSHPHGLTAPANSSTMMQSSDWGSPGGKLDWGIQGDELNKLKKSASFGFRSNNAGTPATFMPSAVGEPDVSWVNSLVRDV
SSERSEQKYHHLNKGVHEMLPPWAEQMYIEQEQRA*

DNA
ATGTGCAAGGGTTCCAAGGATAAGCTTAGCCCCTCCAATTTCACCATGGAAAGCGGATTTCCTAAGCAGAATTCGGTTTT
GGTTGAATTGTCTGCCTCAGACAATCTTGATGCTTTCAGAAGCGAAGTACAAGAGAAAGGTTTCCATGTTGACGAGGCTG
GCTTTTGGTATGGTAGAAGAATTGGGTCAAAGAAGATGGGGTTCGAAGAGAGGACACCGCTTATGATCGCTGCCATGTTC
GGTAGCACCAAGGTTTTGAAGTATATTATTCAGTCTGGTAAGGCTGATGTCAATAGGTCTTGTGGTTCAGATAAGGTCAC
TGCCCTTCACTGTGCCACTGCTGGCGGTTCCACCGCTTCACTTGAGGTTGTCAAGCTCTTGCTTGATGCATCAGCTGATG
CTAATTGCGTCAATGCCAATGGGAATAAGCCTATTGACTTGATTGCCCCTGCTTTGAAGTCACCTTGCAGTTCAAGAAGA
AAGACCATGGAGATGCTGTTGAAAGGTGATATGTCAGTGATGGAAAGTGATCAGATTGCTAACCAAGAGGGAGACCAACA
GAAGTTTCCAAGCCCTCAGCTGTCAAAAGACGGAAGCGAGAAGAAAGAATATCCTATTGATATTTCATTGCCTGATATCA
ACAATGGGATATATGGTACAGATGAGTTCAGAATGTACACTTTCAAGGTGAAGCCGTGCTCGAGGGCCTACTCTCATGAC
TGGACTGAATGCCCTTTCGTTCATCCAGGTGAGAATGCAAGGAGGAGAGACCCAAGAAAGTACCCATATAGCTGTGTACC
CTGCCCTGAGTTCCGCAAAGGGTCGTGCCAGAAGGGAGATGTCTGTGAGTATGCTCATGGTGTTTTTGAGTCCTGGCTTC
ATCCTGCCCAATATCGAACCCGGCTTTGCAAGGATGAAACAGGGTGCACAAGGAAAGTGTGCTTCTTTGCTCACAGACCT
GAAGAATTACGCCCAGTGTATGCTTCCACGGGTTCAGCCATGCCTTCACCAAGGTCTATGTCAGTGAGCGCCGCAGATAT
GGCCAGCCCATTAGCTCTTGGTTCATCACCTATGTCTCAGCCTACCACGTCCACACCGCCCATGTCTCCATTGGCAACCT
CTTCATCTCCCAAGAATGGAGCTTTGTGGCAGAACAAACTTAACCTCACTCCACCTGCCTTGCAGCTTCCAGGCAGCAGG
CTAAAGAGTGCTTTGAGTGCCAGAGATTTGGACTTGGAGATGGAATTGCTAGGACTGGATAGTCATTCTAGCCAACAACA
GAAACATCAACATCAACAGCAGCAGCAACAGCAGTTGTGGGATGAGATATCTCGTCTCTCCTCGCCAAAATGCTACAATA
ACGATTTCAGCAGGATCGGAGAACTGAAGCCAACTAACCTTGACGATGCTTTTGGATCCTTCGATCCTTCTTTATTGTCT
CAATTGCAGGGAGTTTCTCTAAAGCCTTCAACACCAACCCAGTTACAATCTTCTGCGCATCAGATTCGCCAAAACATGAA
CCAACTTCGATCAAGCTACCCAACTAACTTGTCATCCTCTCCGGTGAGGAAGCCCTCCTCATTTGGGCTTGACTCACCTG
GGGCTCTTGCAGCAGCAGTTATGAATTCCAGGTCTGCTGCATTTGCACAGCGAAGTCACAGTTTTATTGACCGTGGAGCA
ATGAGCCATCCTCATGGGCTCACTGCCCCTGCTAATTCTTCCACCATGATGCAGTCTTCAGATTGGGGCTCACCTGGTGG
GAAATTGGATTGGGGAATTCAAGGAGATGAGCTGAACAAGCTGAAGAAGTCTGCTTCTTTTGGGTTCCGAAGCAACAATG
CTGGAACACCAGCCACCTTTATGCCATCAGCTGTTGGTGAGCCAGATGTCTCTTGGGTCAATTCCCTGGTTAGAGATGTT
TCTTCTGAGAGGTCTGAGCAGAAGTACCATCACCTCAATAAGGGGGTTCATGAAATGCTTCCCCCATGGGCGGAGCAGAT
GTACATAGAACAGGAGCAGAGGGCATAA