Details for Peach Locus ppa002277m

Position : sca2 ( 5`- 22350285 .. 22348207 -3` )
Annotation : [B2G] l-type lectin-domain containing receptor kinase
External links : CoGe
PGDD synteny : ppa002277m

Protein [Map View]
MAYQRLILFLVFLLFLTNPVKSQLDEELHFNGFNGVGSNMSLNGVAEIEPNGMLKLTNDTLRVLGHAFYSSPIKFKNSTD
GKAFSFSTAFAFTIVPEYPKLGGHGLAFIISPSKELPGSLPSQYLGILNATVVGNFSNHIFAVEFDTVQDFEFGDINDNH
VGIDINSLASNKSTPAGYFTSQNSTKQSLNLKSGHVIQAWVDYDSVKNQVTVKLSPNSIKPTSPILTFDVDLSPIFQDFM
YVGFSASTGLLASSHYVSGWSFKMNGDAKSLSLDALPKLPGPKKTHTGVIVGVSVSALLVLILGIGLAFYIIHRIKNAEV
IEAWELDIGPHRFTYQELKHATRGFRDKEVIGFGGFGKVYKGTLPNSNTQVAVKRISNESKQGLQEFVSEIASIGRLRHR
NLVQLLGWCRRRGDLLLVYDFMPNGSLDKYLFENPKAILSWEQRFRIVKGVASGLLYLHEGWEQTVIHRDIKAGNVLLDS
ELNGRLGDFGLAKLYEHGSNPTTTRVVGTLGYLAPELTRTGKPTPSSDVFALGALLLEVVCGRRPIEAKAMPEELILVDW
VWDKWRDGTILDVVDPRLEGEFDELEAVVVLKLGIMCSNNTPKARPTMRQVVRYLEGEVALPEVVLSPGAYDGRKDSERG
GEFEDYVHSYPTSSYFEKASAWSCDDADVDFEAASSSSPLSVSGRNGGSCPR*

DNA
ATGGCATATCAAAGACTCATACTTTTCTTGGTTTTTCTCCTTTTCCTCACAAACCCAGTAAAGTCTCAGCTTGATGAAGA
GCTCCACTTCAATGGGTTCAATGGCGTTGGCAGCAACATGAGCTTAAATGGGGTCGCAGAGATCGAGCCCAATGGCATGC
TAAAGCTCACAAACGACACTCTAAGAGTCTTGGGTCACGCTTTCTATTCATCTCCAATCAAATTCAAGAACTCAACTGAT
GGAAAAGCTTTCTCCTTTTCCACCGCTTTTGCTTTCACTATAGTCCCAGAGTACCCCAAGCTCGGCGGCCATGGCCTCGC
CTTCATAATCTCACCTTCAAAGGAGCTTCCTGGATCTCTTCCAAGCCAGTACCTTGGTATTCTCAACGCCACAGTTGTCG
GCAACTTCTCAAACCACATCTTTGCTGTTGAATTTGACACTGTGCAGGACTTTGAATTTGGCGACATCAATGACAACCAT
GTTGGCATCGATATAAACAGCTTGGCCTCCAACAAATCAACTCCAGCTGGGTATTTCACCAGTCAAAATTCAACAAAACA
GAGCCTCAACCTCAAAAGTGGTCACGTAATCCAGGCCTGGGTGGATTACGATTCAGTGAAAAACCAAGTAACTGTTAAGC
TTTCCCCTAATTCTATCAAACCCACATCTCCAATTTTAACCTTCGATGTGGATCTCTCTCCAATTTTTCAAGATTTTATG
TACGTTGGCTTCTCTGCCTCAACTGGGTTGCTAGCCAGCTCGCACTATGTCTCTGGTTGGAGCTTCAAAATGAATGGAGA
TGCCAAATCTCTCTCTTTGGATGCTCTGCCTAAACTCCCTGGGCCCAAAAAAACACACACAGGTGTAATTGTGGGTGTTT
CTGTTTCTGCTCTTCTGGTCTTGATCTTAGGCATTGGGTTGGCTTTCTACATCATTCACAGAATCAAGAACGCTGAGGTG
ATTGAAGCTTGGGAGCTTGACATTGGTCCTCACAGATTCACATACCAGGAGCTGAAGCATGCCACAAGAGGCTTCAGAGA
CAAAGAGGTAATTGGGTTTGGTGGGTTTGGTAAAGTTTATAAGGGAACTTTGCCAAACTCAAATACCCAAGTTGCTGTTA
AGAGAATATCCAATGAATCAAAACAGGGTCTTCAAGAATTTGTGTCTGAAATTGCTAGCATTGGTCGTCTTCGCCATAGA
AATTTAGTTCAATTATTGGGTTGGTGTCGTAGGCGTGGTGATTTGTTGCTTGTATATGATTTTATGCCTAATGGGAGCTT
GGACAAGTATCTGTTTGAAAACCCCAAAGCAATTTTGAGCTGGGAGCAGAGGTTCAGGATTGTCAAAGGTGTAGCTTCAG
GGCTATTGTATTTACATGAAGGTTGGGAGCAAACTGTGATTCATAGAGACATTAAAGCAGGAAATGTGTTGTTGGATTCT
GAGCTAAATGGAAGGCTTGGTGACTTTGGTCTTGCTAAGCTGTATGAGCATGGCTCAAACCCAACAACAACCAGGGTGGT
TGGCACACTGGGTTACCTCGCTCCTGAGTTGACTCGGACTGGAAAACCTACTCCCAGCTCAGATGTGTTTGCTCTGGGAG
CTCTTTTGCTTGAGGTGGTTTGTGGGAGGAGACCCATTGAGGCCAAAGCCATGCCTGAGGAGCTCATTTTGGTGGACTGG
GTTTGGGACAAATGGAGAGATGGTACAATTCTTGATGTTGTGGACCCAAGATTGGAGGGTGAGTTTGATGAGCTTGAGGC
TGTTGTGGTGCTTAAACTCGGCATAATGTGTTCCAATAATACCCCCAAGGCAAGACCTACAATGAGACAGGTGGTGAGGT
ACTTGGAGGGTGAGGTGGCACTGCCTGAGGTGGTTTTGTCTCCTGGGGCATATGATGGGAGAAAAGACAGTGAGCGTGGT
GGTGAGTTTGAGGATTATGTGCATTCGTATCCAACATCTTCATATTTTGAGAAGGCAAGTGCATGGTCATGTGATGATGC
AGATGTTGATTTTGAAGCTGCTTCTTCAAGCTCACCTCTCTCAGTATCTGGTAGAAATGGTGGTAGCTGCCCAAGATAG