Details for Peach Locus ppa002098m

Position : sca2 ( 5`- 22469982 .. 22464172 -3` )
Annotation : [B2G] pyrroline-5-carboxylate synthetase
External links : CoGe
PGDD synteny : ppa002098m

Protein [Map View]
MDEVDRSRAFLKDVKRIVLKVGTAVVTRNDGRIALGRLGALCEQLKELNSLGYEVILVSSGAVGLGRQRLRYRKLVNSSF
ADLQKPQVELDGKACAAVGQNCLMALYDTLFSQLDVSSAQLLVTDSDFRDRDFRKQLSDTVKSLLSLKVIPIFNENDAVS
TRRAPYEDSSGIFWDNDSLAALLALELKADLLVLLSDVDGLYSGPPSDPRSKIIHTYIKEKHQSEITFGDKSRVGRGGMT
AKVKAAVNAAYAGIPVVITSGYAPGNLSKVLEGQRVGTLFHQDAHLWSPVKEVDARGMAVAARESSRRLQAMTSEERKRV
LLDVADALEANVRLINVENEADVSAAQEAGYEKSLISRLALKPGKIKSLANSIRVLANMEDPIGHVLKRTQLAEGLVLEK
TSSPLGVLLIVFESRPEALVQIASLAIRSGNGLLLKGGKEAKRSNAILHKIITGAIPDSVGGKLIGLVTSREEIPDLLKH
DDVIDLVIPRGSNKLVSQVKNLTKIPVLGHADGICHVYIDKSANMDMAKRIAVDAKVDYPAACNAMETLLVHKDLKDTTE
FNDLVVDLRAEGVTLYGGPRASSLLNIPQAHSFHHEYSSMACTVEFVDDVHAAIDHIHEHGSAHTDCVIAEDLEVVDAFL
GQVDSAAVFHNASPRFCDGARFGLGAEVGISTSRIHARGPVGVEGLLTTRWILRGNGQVVDGDKGVIYTHKDLPIEP*

DNA
ATGGACGAAGTGGATCGTTCTCGAGCTTTTCTCAAAGACGTTAAGCGCATCGTTCTCAAGGTTGGGACTGCGGTTGTGAC
TCGAAACGATGGAAGAATTGCGCTGGGAAGATTAGGCGCGCTGTGTGAGCAGCTCAAGGAGTTGAACTCTCTAGGATATG
AGGTTATATTGGTGTCATCAGGAGCGGTGGGCCTCGGTCGTCAGAGGCTTAGATACAGGAAATTAGTGAACAGCAGTTTT
GCTGATCTGCAAAAACCGCAAGTGGAACTTGATGGGAAGGCATGTGCAGCTGTTGGACAAAACTGTCTGATGGCTCTCTA
TGATACGTTGTTTAGTCAGTTGGATGTCTCATCAGCTCAGCTTCTTGTAACAGATAGTGATTTTAGGGATAGAGATTTTA
GAAAGCAACTTAGTGACACCGTGAAATCATTGTTATCTCTTAAGGTTATTCCTATATTTAATGAAAATGATGCAGTCAGC
ACCAGGCGAGCTCCATATGAGGATTCTTCTGGAATATTTTGGGATAATGACAGTTTGGCAGCTCTACTGGCTTTGGAGCT
AAAAGCTGATCTTCTTGTTCTTTTGAGTGATGTGGACGGTTTATACAGTGGGCCTCCAAGTGACCCACGTTCGAAGATTA
TCCATACATACATAAAGGAGAAGCATCAAAGTGAAATTACTTTTGGAGACAAATCTAGAGTGGGAAGAGGGGGCATGACT
GCTAAAGTAAAAGCTGCTGTCAATGCAGCTTACGCTGGCATCCCTGTTGTTATCACCAGTGGGTATGCTCCGGGAAACCT
CAGTAAAGTACTTGAAGGACAACGTGTTGGTACCCTCTTCCATCAAGATGCACATTTATGGTCTCCAGTTAAAGAAGTTG
ATGCAAGAGGGATGGCAGTTGCGGCCAGGGAAAGTTCAAGAAGGCTTCAGGCCATGACTTCTGAAGAAAGGAAAAGAGTT
CTTCTGGATGTAGCTGATGCCCTTGAAGCAAATGTAAGGTTGATCAATGTTGAAAATGAAGCTGATGTTTCTGCTGCACA
AGAAGCGGGATATGAAAAATCCTTGATATCTCGGCTGGCTCTAAAGCCTGGGAAGATTAAAAGTCTGGCAAACTCTATCC
GTGTGCTTGCAAACATGGAAGATCCAATTGGTCATGTTTTGAAAAGAACTCAGCTTGCAGAAGGTCTCGTCTTAGAGAAA
ACATCAAGCCCATTGGGTGTTCTCCTGATTGTATTTGAGTCTCGTCCTGAAGCGCTAGTACAGATAGCTTCATTAGCGAT
CCGAAGTGGGAATGGGCTTCTCTTAAAGGGTGGAAAAGAGGCTAAGAGATCAAATGCAATTTTACACAAGATTATAACTG
GAGCCATCCCAGACAGTGTTGGTGGAAAACTAATTGGACTTGTCACTTCAAGAGAGGAGATTCCAGATCTTCTTAAGCAC
GATGACGTGATTGATCTTGTGATCCCAAGGGGCAGCAATAAACTGGTTTCTCAAGTCAAGAATTTAACCAAGATTCCAGT
TCTTGGGCATGCTGATGGCATATGCCATGTGTATATTGATAAGTCTGCTAATATGGATATGGCAAAGCGAATTGCTGTGG
ATGCAAAAGTAGATTATCCAGCAGCCTGTAACGCGATGGAAACACTTCTTGTCCATAAGGATTTAAAGGATACAACTGAG
TTCAATGATCTTGTGGTTGACCTTCGCGCTGAAGGTGTTACTTTATATGGTGGACCAAGGGCAAGCTCCTTGCTCAATAT
TCCACAAGCGCATTCATTCCATCATGAGTACAGTTCAATGGCTTGCACTGTTGAGTTTGTGGATGATGTGCATGCAGCCA
TTGATCATATACATGAACATGGAAGTGCACATACTGATTGCGTTATCGCAGAAGACCTAGAAGTTGTAGATGCCTTTTTA
GGTCAAGTTGACAGTGCTGCCGTTTTTCACAATGCAAGCCCAAGATTTTGTGATGGCGCTCGATTTGGACTTGGCGCAGA
GGTTGGGATAAGCACGAGTCGAATTCATGCTCGGGGCCCTGTAGGAGTAGAAGGATTGTTAACAACAAGATGGATTCTCA
GAGGAAATGGACAAGTTGTGGACGGTGATAAGGGGGTTATTTACACCCACAAGGACCTCCCAATTGAGCCCTAA