Details for Peach Locus ppa001873m

Position : sca2 ( 5`- 23349515 .. 23353632 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001873m

Protein [Map View]
MKTHTNRGFATTGPLHATSLPRASPEISLRRQLPAGIHVFRRVSYCKRHRTKVSVILRQNQAETSKQNIANSIESADDCN
EARRSPLHTRRHALLAPSLALGAWFLKSTVASAEDAPSPPPSPSQTDAITSRIYDASAIGEPVAVGKDKSKVWEKVMNAR
ILYLGEAEQVPIRDDKELELEIVKNLWKRCLESERALSLALEAFPSDLQDQLNQYMKKSIDGDALKSYTSHWPSQRWQEY
EPLLSYCRDNGVRLVACGTPLKVLRTVQSKGISGLSKADRKAYAPPAGSGFISGFTSSTRRTPVDSNSPNQSVPFGPSSY
LSAQARVVEDYTMSQIILQAMVDGGASGMLVVVTGASHVRYGIRGTGLPARISTKLQKKNQVVILLDPERQHIRQEGEVP
VADFLWYSAARPCNRNCFDRAEISRVMNAAGRRRDALPQDLQKGLDLGLVSPEVLQNFFDLEQYPLISELTQRFQGFRER
LLADPKFLHRLAIEEAISITTTLFAQYERRKENFFEELDYVITDTLRGSVVDFFTVWLPAPTLSFLSYADEINVPDSMDA
IKGLIGSIPDNAFQKNLLGKDWSINYRLASVLLGGLKLAGVGIISSIAAVAASNGLFAVRRFINPALVNNQQKKRTPILK
TAIIYGGFLGTSANLRYQIIAGVIEHRLSDEFSSQTLLVNMLSFVSRTINSYWGTQQWIDLARFTGLQTRKSESSQMLDS
TNQTPDSTNQMPALECNNTEETNVDEIQNK*

DNA
ATGAAGACCCACACTAACAGAGGCTTCGCCACAACTGGACCACTCCACGCAACATCTCTTCCCCGAGCCTCACCGGAAAT
TTCCCTTCGCCGCCAACTTCCAGCCGGAATCCATGTTTTTCGGCGAGTTTCATACTGTAAACGCCACCGCACCAAAGTCT
CCGTCATTCTCCGCCAGAATCAGGCCGAAACTTCCAAGCAGAATATCGCAAATTCGATAGAAAGTGCCGATGATTGCAAC
GAAGCTCGCCGGAGTCCGCTCCACACGAGGCGACACGCGCTACTCGCCCCTTCGCTGGCGCTCGGCGCGTGGTTTCTAAA
ATCGACAGTGGCGAGCGCAGAGGACGCTCCATCGCCACCGCCGTCGCCGTCACAAACCGATGCGATAACGTCAAGAATAT
ACGACGCGTCGGCGATTGGAGAGCCCGTGGCGGTGGGGAAGGACAAGAGCAAGGTGTGGGAGAAGGTGATGAATGCTCGG
ATATTGTACTTAGGTGAAGCCGAACAGGTTCCGATTCGCGACGACAAAGAATTGGAGCTGGAGATTGTGAAGAACTTGTG
GAAAAGGTGTTTGGAGAGTGAGCGAGCCTTATCTTTGGCTCTTGAAGCATTTCCTTCTGATCTTCAGGACCAGCTCAATC
AGTATATGAAGAAAAGCATAGATGGAGATGCTTTGAAGTCCTACACATCACATTGGCCATCTCAACGCTGGCAGGAGTAT
GAGCCCCTTCTAAGTTACTGTCGCGACAATGGAGTTCGGCTTGTGGCTTGTGGTACTCCACTCAAGGTTTTACGGACTGT
CCAATCGAAGGGAATTAGTGGGCTTTCAAAGGCTGATCGTAAAGCGTATGCTCCTCCAGCAGGTTCAGGCTTTATCTCAG
GCTTCACTTCTAGCACACGCAGAACACCAGTTGATTCGAATTCTCCGAATCAATCTGTGCCTTTTGGGCCAAGCTCATAT
CTTTCTGCACAAGCAAGAGTGGTTGAGGATTATACTATGTCCCAGATTATCTTACAGGCCATGGTGGATGGAGGAGCAAG
TGGTATGCTAGTGGTGGTGACAGGTGCAAGCCATGTTAGATATGGGATTAGAGGGACAGGACTGCCAGCTAGAATTTCAA
CAAAGTTGCAAAAGAAAAACCAAGTAGTTATATTACTTGATCCTGAAAGACAGCACATACGACAGGAGGGAGAAGTTCCT
GTTGCTGATTTCTTGTGGTATTCTGCTGCCAGACCCTGCAACAGGAATTGTTTTGATCGTGCTGAAATTTCCCGAGTTAT
GAATGCAGCAGGCAGGAGGCGAGATGCCCTTCCACAGGATCTTCAAAAAGGACTGGATCTTGGTTTGGTATCTCCAGAGG
TATTACAGAACTTCTTTGATCTGGAGCAGTATCCTCTTATTTCAGAACTCACTCAACGTTTCCAGGGTTTCAGGGAAAGA
TTGTTGGCAGATCCTAAGTTCTTGCATAGATTAGCCATCGAAGAAGCTATATCAATAACTACTACTCTCTTTGCACAGTA
TGAGAGGCGCAAAGAAAATTTCTTTGAAGAGCTGGACTATGTTATCACGGACACTCTAAGGGGATCAGTTGTTGATTTCT
TTACAGTGTGGCTTCCTGCCCCGACATTGTCATTTCTTTCATATGCCGATGAGATCAATGTGCCTGATAGCATGGATGCT
ATTAAAGGTCTCATTGGGTCCATCCCTGATAATGCATTTCAAAAGAATCTTTTGGGGAAAGATTGGAGTATCAATTATAG
ACTTGCATCTGTGCTTTTGGGAGGTCTAAAACTAGCTGGTGTTGGCATTATTTCCAGTATTGCGGCTGTTGCTGCCTCAA
ATGGTCTGTTTGCAGTTCGCAGATTCATTAATCCAGCTCTGGTCAATAATCAGCAAAAGAAAAGAACTCCAATACTTAAA
ACGGCAATAATCTATGGAGGCTTTCTTGGAACATCGGCAAATCTCCGTTATCAGATTATTGCTGGAGTAATAGAACATCG
ACTTTCTGACGAATTTTCTTCTCAAACATTGCTTGTAAATATGCTGTCTTTTGTTTCTCGGACAATAAACTCTTATTGGG
GAACTCAGCAATGGATTGATCTTGCACGCTTTACTGGTCTGCAAACGCGGAAGAGTGAATCGTCCCAAATGCTAGATTCT
ACTAACCAAACGCCAGATTCTACTAACCAAATGCCAGCACTGGAATGTAACAACACAGAGGAGACAAATGTAGATGAAAT
CCAGAACAAATGA