Details for Peach Locus ppa001680m

Position : sca5 ( 5`- 18141178 .. 18148857 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001680m

Protein [Map View]
MAGYERDEVPMLSDTHPQLSDENVHLQFETFMSRTRSASVSIPMDSMDSSFEREASLVSHTGPLRSRTKTPFLPMSGPLY
NRRPDNIFRLTQAVPGQEEAVKPAGEKFPSTNVTNQNEGTDDNYAGKNEHLLRSGQLGMCNDPYCTTCPTYNLKAAQPQH
SKASGIFDPKFHNALYGDAKGWARRFFSFLRLYIPGVMNPHAKVVQQWNKFFVISCLVAIFVDPLFFFVLSVRKDNKCIV
LDWPMTTTLVVFRSMTDFIYLMHILLQFRLAYVAPESRVVGAGELVDHPKKIARNYLQGYFLIDFFVVLPLPQIIILLVL
RKNLGLSGANYAKNLLRAAVLLQCIPRLCRCLPLLAGQSPSGFIFESAWANFIINLLTFVLSGHVVGSCWYLFGLQRVNQ
CFRDVCHDSGIRGCMSFIDCGHGNEIEGSKVEDPVRDSWKNYTNANACLDKDGFDYGIYSQAVNLTTENSIITRYVYALF
WGFQQISTLAGNQTPSYFVWEVLFTMAIIGLGLLLFALLIGNMQNFLQALGRRRLEMSLRRRDVEQWMRHRRLPGELRRR
VRQAERYNWAATRGVNEEILLENLPEDLQTDIRRHLFKFIKKVRIFSLMDEPILDSICGRLRQKIYIKGSKVLYHGGLIE
KMVFIVRGKMESIGEDGITVSLSEGDVCGEELLTWCLEHSSANRDGKIRIPGQRLLSNRMVRCLTNVEAFSLRAADIEEV
TSLFSRFLRKPRVQGAIRYESPYWRGLAARRIQVAWRYRRKRLSRADTSQSQSNHIHNHAL*

DNA
ATGGCTGGTTATGAAAGAGATGAGGTACCCATGCTATCGGACACTCACCCACAATTATCAGATGAAAATGTGCACTTACA
ATTTGAGACATTTATGTCACGAACCAGAAGTGCATCAGTTTCCATTCCTATGGACTCTATGGACTCGTCATTTGAAAGGG
AGGCTAGCCTTGTAAGCCATACTGGTCCCTTGAGGAGTCGAACAAAAACTCCATTCCTCCCTATGAGTGGTCCATTATAT
AACCGCAGGCCTGATAACATTTTCCGGCTAACTCAAGCTGTACCAGGGCAAGAAGAAGCAGTCAAACCTGCAGGAGAAAA
GTTTCCTTCTACTAATGTGACAAACCAGAATGAAGGGACAGATGACAACTATGCTGGAAAAAATGAACACTTACTGAGAT
CTGGGCAATTGGGGATGTGCAATGATCCTTACTGCACAACTTGCCCAACATACAATCTCAAGGCTGCTCAACCACAACAC
TCAAAGGCTTCGGGTATATTTGATCCCAAGTTCCATAATGCTCTCTATGGGGATGCCAAAGGCTGGGCGAGGAGATTTTT
CTCTTTTCTGCGTCTATATATTCCTGGAGTTATGAACCCTCATGCTAAAGTGGTGCAACAGTGGAACAAGTTTTTTGTCA
TTTCATGCTTAGTAGCAATTTTTGTAGATCCATTGTTTTTCTTCGTGCTGTCTGTTCGAAAGGATAATAAATGCATAGTT
CTTGATTGGCCCATGACGACAACACTTGTGGTTTTTAGAAGCATGACTGATTTTATATACTTGATGCACATACTCCTTCA
GTTTAGATTGGCTTATGTGGCTCCTGAGTCTAGGGTGGTTGGTGCTGGCGAGTTGGTTGACCATCCAAAGAAAATTGCTC
GGAATTACCTTCAAGGATATTTTCTAATTGACTTCTTTGTTGTATTACCGCTTCCTCAGATCATAATTTTGTTAGTTCTA
CGAAAAAACTTGGGATTATCTGGAGCAAACTATGCAAAAAATTTGTTACGTGCTGCAGTTCTTCTTCAGTGCATTCCCAG
GTTGTGTAGGTGTCTACCCCTGCTTGCTGGTCAGTCTCCAAGTGGCTTCATATTTGAGTCCGCATGGGCAAACTTCATAA
TAAATCTTCTCACATTTGTGTTGTCTGGCCATGTTGTTGGGTCGTGCTGGTACCTCTTCGGGTTACAGAGGGTTAATCAA
TGTTTTCGAGATGTCTGTCATGACTCTGGAATTCGTGGGTGCATGAGCTTCATAGATTGTGGGCATGGAAATGAGATTGA
AGGTTCTAAAGTGGAAGATCCAGTACGTGATAGCTGGAAAAACTATACGAATGCTAATGCTTGTTTAGATAAAGATGGTT
TTGATTACGGAATCTACAGCCAAGCTGTCAATCTTACAACAGAAAATAGCATAATCACGAGATATGTATACGCACTGTTT
TGGGGATTCCAGCAAATCAGTACTCTGGCTGGAAATCAAACTCCAAGTTATTTTGTTTGGGAAGTCCTTTTTACAATGGC
TATTATTGGCCTAGGTCTCTTGCTTTTTGCTCTTCTCATTGGAAATATGCAGAACTTTCTGCAGGCTCTTGGTCGGAGAA
GGTTAGAAATGTCTCTGAGACGTCGTGACGTTGAGCAGTGGATGAGACATAGACGCTTGCCAGGGGAACTTAGAAGGCGA
GTACGACAAGCTGAAAGGTACAATTGGGCCGCAACCAGAGGGGTAAATGAAGAAATCCTTTTGGAAAACTTGCCTGAAGA
CCTTCAGACAGATATAAGACGCCATCTCTTCAAGTTTATTAAGAAAGTACGAATTTTTTCCCTGATGGATGAACCCATCT
TGGATTCCATTTGTGGAAGACTAAGACAAAAGATATACATCAAAGGAAGCAAAGTTTTGTACCATGGTGGTCTAATTGAG
AAAATGGTTTTTATCGTGCGTGGAAAAATGGAGAGCATTGGAGAAGATGGGATTACAGTTTCCTTATCTGAAGGGGATGT
TTGTGGTGAGGAACTTCTCACATGGTGCCTTGAGCATTCTTCAGCGAACAGAGACGGTAAGATCAGGATTCCTGGACAGC
GATTGCTTAGCAACAGGATGGTGAGATGCTTAACAAACGTCGAAGCATTTTCACTCCGAGCTGCAGACATTGAAGAAGTC
ACCAGTCTTTTCTCCAGATTTTTGCGAAAACCACGTGTTCAAGGAGCCATAAGATATGAATCACCTTACTGGAGAGGGCT
TGCAGCAAGACGCATTCAAGTAGCATGGAGATACAGGAGAAAACGCCTAAGTCGAGCAGACACCTCTCAATCCCAATCCA
ATCATATTCATAACCATGCATTATAA