Details for Peach Locus ppa001662m

Position : sca3 ( 5`- 19513697 .. 19517763 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001662m

Protein [Map View]
MKFGKEFVSQMVPEWQEAYMDYNSLKLLLKDILCFRQCNKVTTPMASTPEGSSLKRRVSLYRAFSGLTSRHRGSPKKKED
EEILVSEEGAERQWQTMFLMSSDEGGDIEVVFFKRLDEEFNKVINFYKKKVGEVVDEAEELSRQMDALIALRLKVENPLV
ELGGTDVIDRGSNGVSSQSTVHPTSGRRPGGPQMDVIPEVEMSNEGEMEDEERGSKESKTSDQKGNGSTADIKGFKPPSL
EILDHVKINVTPETPISTVKGILKSSKPDLSFSKKELRKAEEQMTEAFNEFYQKLRLIKSYCFLNQLAFSKIMKKYDKIS
SRNASKAYLNMVDNSYLGSCDEVTRIMERVEATFIKHFTNGNRREGMKTLRPRARREKHRSTFFLGLFSGVSIALVVAII
VLIHARNIFRSEGRGQYMENIFPLYSLFGFMVLHMLMFSANIYYWRRYRVNYPFIFGFQQGAELGYRQFFLLSSGLAILA
LAGVLSNLDMEMDPSTKSFRALTELVPLGLVTVVLLIMFCPFNIIYRSSRFFLLQCIFHCLCAPLYKVSLPDFFLADQLT
SQVQAFRSLEFYVCYYGWGDFKKRSHNCLDSRVYRSFYFIVAIIPYWIRSLQCLRRLIEEKDGMQGLNGLKYFSTILAVA
MRTSFDMKKGMTWKVLAITSSAVATIVSTYWDIVIDWGLLRRNSRNPWLRDKLLISNKSVYFIAMVLNVILRLAWMQSVL
GIKEVPFVHRTALVAIVACLEIIRRGIWNFFRLENEHLNNVGKFRAFKSVPLPFNYDCDESKSR*

DNA
ATGAAGTTTGGAAAAGAGTTTGTGTCCCAAATGGTGCCAGAATGGCAAGAGGCTTACATGGACTACAACTCTCTCAAGCT
TCTCTTGAAAGACATCTTGTGTTTTAGGCAGTGCAACAAAGTAACAACACCAATGGCATCAACTCCTGAAGGGTCATCGT
TGAAGAGAAGGGTGTCTCTCTACAGAGCTTTTAGTGGGCTAACAAGCCGGCATCGAGGCTCTCCGAAGAAGAAAGAGGAT
GAAGAGATTCTTGTTAGTGAAGAAGGGGCAGAAAGGCAGTGGCAGACAATGTTTTTGATGTCCTCTGATGAAGGAGGAGA
CATTGAGGTTGTGTTTTTTAAGAGGCTTGATGAGGAGTTTAATAAAGTCATCAACTTCTACAAGAAGAAAGTTGGGGAAG
TGGTGGATGAGGCAGAGGAGTTGAGCAGACAGATGGATGCTTTAATTGCTCTTAGGCTGAAGGTTGAGAATCCACTGGTG
GAACTGGGAGGAACTGATGTGATAGACAGGGGAAGCAATGGGGTTTCCTCGCAATCAACTGTTCATCCCACTAGTGGCAG
AAGGCCAGGAGGGCCTCAGATGGATGTGATTCCAGAAGTTGAGATGAGCAATGAAGGAGAAATGGAAGATGAAGAGAGAG
GAAGCAAAGAATCAAAAACCAGTGACCAGAAAGGCAATGGAAGCACGGCGGATATTAAGGGATTTAAACCACCTTCACTA
GAGATCCTGGATCATGTAAAGATCAATGTGACACCTGAAACTCCGATATCAACAGTGAAAGGCATCCTCAAGAGTTCAAA
ACCAGACTTATCATTCAGCAAGAAAGAGTTGAGGAAAGCAGAAGAGCAAATGACAGAGGCTTTTAATGAGTTCTACCAAA
AGCTTCGGCTTATAAAAAGTTACTGTTTCCTGAATCAATTGGCTTTTTCAAAGATCATGAAGAAATATGACAAGATCTCT
TCAAGGAATGCATCAAAGGCTTACTTGAATATGGTGGATAATTCTTATCTCGGAAGCTGTGATGAAGTTACTAGGATCAT
GGAAAGGGTGGAGGCTACCTTCATAAAGCACTTTACAAATGGAAATCGCAGAGAAGGAATGAAGACATTAAGACCAAGAG
CCAGAAGGGAAAAGCATAGAAGTACATTTTTTTTGGGGTTGTTCTCTGGGGTCTCAATTGCACTTGTAGTAGCCATCATT
GTGCTTATACATGCAAGAAATATCTTTAGGAGTGAAGGGCGTGGTCAGTACATGGAAAACATATTTCCTCTATACAGCTT
GTTTGGATTCATGGTCCTACATATGCTCATGTTCTCAGCAAACATATACTATTGGAGGCGATACCGAGTAAATTATCCAT
TTATTTTTGGCTTCCAGCAAGGGGCAGAGCTGGGTTACAGACAGTTTTTCCTTCTCAGTTCGGGTCTTGCAATTCTCGCC
TTGGCTGGTGTCCTCTCAAATTTGGATATGGAGATGGACCCAAGTACAAAAAGCTTCAGAGCTTTAACTGAGTTAGTCCC
TTTGGGCCTAGTCACTGTTGTGCTTCTTATAATGTTTTGTCCTTTCAACATAATATATCGTTCCAGTCGATTTTTCCTCC
TCCAATGTATATTCCATTGCCTTTGTGCTCCACTTTATAAGGTTTCCCTCCCAGATTTTTTCTTGGCAGATCAGCTTACT
AGCCAGGTTCAAGCCTTCAGGAGTTTGGAATTCTATGTTTGCTATTATGGTTGGGGGGACTTCAAAAAAAGATCACACAA
CTGCCTCGACAGCCGTGTATATAGATCTTTCTACTTCATTGTAGCAATTATTCCTTATTGGATCCGTTCCCTTCAGTGCC
TTCGACGCTTGATAGAAGAGAAAGATGGAATGCAAGGGTTAAATGGGCTGAAATACTTTTCAACAATTCTTGCAGTAGCC
ATGAGAACAAGTTTTGATATGAAAAAGGGGATGACGTGGAAGGTCCTTGCCATAACTAGTTCAGCTGTGGCAACAATTGT
TAGTACATATTGGGATATAGTCATAGATTGGGGTCTTTTGCGCCGGAATTCTAGAAACCCCTGGCTTAGAGATAAACTCC
TCATATCAAACAAAAGTGTTTATTTTATAGCCATGGTGTTGAATGTTATACTGAGACTCGCTTGGATGCAATCAGTATTA
GGAATTAAAGAAGTGCCTTTCGTCCACAGAACAGCCTTAGTTGCAATAGTTGCCTGTTTAGAAATTATTCGTCGTGGCAT
TTGGAATTTCTTTCGGTTGGAGAATGAGCACTTGAACAATGTGGGAAAGTTTCGGGCATTCAAGTCTGTACCCCTACCTT
TCAACTATGACTGTGATGAGAGCAAGAGCAGATAA