Details for Peach Locus ppa001538m

Position : sca2 ( 5`- 22950548 .. 22947996 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001538m

Protein [Map View]
MTKLPFSFLTTFTTFITTLLFTLPSNHALGSGSTLAIVSASGTVCGLVSGQPRQRILCYRRGENVTVEPNISFSAISGGR
TFLCGIRSGGYSLLCWENFSSRNSTFHSKRLYFNETFLLENLSVGDSHICARVVGTGAVKCWRAKDFSEFPSGSEQFESI
SSGSGFSCGILKSSLRVRCWGSGSTLMANETENGFRNMSMLSIVAGGSHVCGLNITGLLVCKGSNDHGQLNAPIGSPFEY
SALALGGNHSCAIRTLNQSVICWGGGGEYSVNETKGVSFETIVSGLNFTCGLTTMNLSIICWGPGWPGSGDELDLPQLLP
GPCVPSSCNCGIYPESQKLCDGSGNICKPCVRPISLPPPPPTPPALPLPPSPSVSPPSPPSKALTTGLLAFAIVGSVGIF
AGICTIVYCLWTGVCFGDKKIHNSVQPTITRAASSNNGNGTTSNNSPPSRSSTIRRQGSRIMRRQRSGTSSAKHPDRAEE
FSLAELATATNDFSSENKIGAGSFGVVYRGKLSDGREVAIKRGETASKMKKFQEKESAFDSELAFLSRVHHKHLVRLVGY
CEERDERLLVYEYMKNGALYDHLHDKNNVEKSSSLLNSWKMRIKVALDAARGIEYLHNYAVPSIIHRDIKSSNILLDNNW
TARVSDFGLSLMGPEADADYRPKKAAGTVGYIDPEYYGLNLLTAKSDVYGLGVVLLELLTGKRAIFKDGENGGTPISVVD
FAVPAIMAGELARVLDRRVGPPEVNEAEAVELVAYTAMHCVNLEGKDRPTMADIVANLERAFSLCDESHGSISSGAISIT
SAELD*

DNA
ATGACGAAACTACCCTTCTCTTTCCTCACCACCTTCACCACCTTCATCACCACCCTCCTCTTCACCCTCCCCTCAAATCA
TGCCTTAGGCTCCGGCTCCACCCTCGCCATCGTCTCCGCCTCCGGCACCGTATGCGGCCTCGTTTCAGGCCAACCGCGGC
AGCGCATACTCTGCTACCGCCGTGGAGAAAACGTCACCGTCGAACCCAACATCTCGTTCTCCGCCATCTCCGGCGGCCGG
ACATTCCTCTGCGGCATCCGCTCCGGCGGCTACAGCCTCCTCTGCTGGGAGAACTTCTCGTCCCGAAACTCGACCTTTCA
TTCCAAACGCCTATACTTCAACGAAACCTTTTTGTTAGAAAATCTGTCAGTCGGCGACAGCCATATCTGCGCTAGAGTGG
TCGGTACAGGCGCTGTGAAATGCTGGAGAGCCAAGGACTTCTCCGAATTTCCATCTGGGTCGGAGCAATTCGAGTCAATT
TCATCTGGGTCGGGCTTCTCTTGCGGAATTTTGAAGTCTAGCCTTCGGGTTCGGTGTTGGGGGTCTGGTAGTACTTTAAT
GGCGAATGAGACTGAAAACGGGTTCAGGAACATGTCAATGTTGAGCATTGTAGCCGGTGGTTCGCACGTGTGTGGGCTCA
ACATTACTGGGCTTCTGGTCTGCAAAGGGAGCAATGATCATGGCCAGTTAAACGCCCCTATTGGCTCGCCATTTGAATAC
TCTGCTTTGGCCCTTGGAGGTAACCACAGTTGCGCAATCAGGACATTAAACCAGTCTGTGATTTGTTGGGGCGGCGGAGG
CGAATATTCAGTCAACGAAACCAAGGGGGTGTCTTTTGAAACCATTGTTTCTGGGTTGAATTTCACTTGTGGATTGACCA
CGATGAATTTGTCAATTATTTGTTGGGGTCCTGGTTGGCCTGGGTCAGGGGATGAGCTCGATTTGCCTCAGCTTCTTCCA
GGCCCTTGTGTTCCATCTTCTTGCAACTGTGGTATTTATCCCGAATCTCAAAAACTCTGTGATGGCTCTGGTAACATTTG
CAAGCCCTGTGTGCGTCCAATTTCATTGCCACCGCCACCACCAACACCACCGGCATTGCCATTGCCGCCATCTCCATCAG
TTTCGCCCCCATCACCTCCATCTAAGGCTCTGACGACGGGTTTATTGGCGTTTGCGATTGTGGGTTCTGTAGGAATCTTT
GCAGGTATTTGCACAATTGTTTATTGTTTATGGACAGGCGTTTGTTTTGGGGACAAGAAAATTCACAATTCAGTGCAGCC
TACAATCACCAGAGCTGCTAGCTCTAACAATGGCAATGGCACAACATCAAACAATAGCCCCCCATCGAGATCGTCCACCA
TTAGGCGCCAAGGGTCGAGAATTATGAGGCGCCAGAGGAGTGGAACCTCGTCGGCGAAACACCCCGACAGGGCAGAGGAG
TTCTCACTGGCGGAGCTTGCAACAGCCACCAATGACTTCTCATCGGAGAACAAGATTGGCGCTGGAAGCTTTGGTGTTGT
GTACAGAGGCAAACTGAGTGATGGGCGTGAGGTGGCCATCAAAAGAGGCGAAACAGCGTCGAAGATGAAGAAGTTTCAAG
AGAAAGAGAGTGCCTTTGACTCAGAATTGGCCTTCTTGTCAAGGGTTCATCACAAACACTTGGTGAGGCTTGTTGGGTAC
TGTGAAGAGAGGGATGAGAGGCTCTTGGTTTATGAATACATGAAAAACGGTGCGCTGTATGATCATTTGCATGACAAGAA
CAATGTCGAAAAGAGTAGTAGTTTATTGAATTCGTGGAAAATGAGGATCAAGGTGGCCTTAGATGCTGCTCGAGGCATCG
AATATCTGCACAATTATGCAGTCCCTTCTATAATTCACAGGGACATAAAGTCATCAAACATTCTGCTGGACAACAATTGG
ACAGCCAGAGTCTCCGATTTCGGGTTGTCGTTGATGGGTCCTGAAGCAGATGCTGATTACAGGCCAAAGAAGGCCGCTGG
AACAGTTGGCTACATTGATCCAGAGTACTATGGCCTCAACTTGTTGACAGCAAAGAGTGATGTGTATGGGCTTGGAGTGG
TGCTGTTGGAGCTTTTGACAGGGAAGAGGGCAATATTCAAGGACGGCGAGAACGGAGGGACCCCGATAAGTGTCGTGGAC
TTTGCCGTGCCGGCGATTATGGCCGGAGAGCTGGCGAGGGTGTTGGACAGAAGGGTTGGGCCTCCGGAAGTGAATGAAGC
TGAGGCGGTTGAGCTGGTGGCATATACTGCAATGCATTGTGTGAATTTGGAAGGGAAAGATAGGCCAACCATGGCTGATA
TTGTGGCCAATTTGGAAAGGGCATTTAGTCTCTGCGATGAAAGCCATGGCAGCATCTCCAGTGGTGCAATCTCAATCACC
TCTGCAGAATTAGACTAA