Details for Peach Locus ppa001448m

Position : sca2 ( 5`- 21380830 .. 21373297 -3` )
Annotation : [B2G] uncharacterized protein loc100255322
External links : CoGe
PGDD synteny : ppa001448m

Protein [Map View]
MKSATKVSLNPLVAYEHKRDAYGFAVRPQHVQRYREYATIYKEEEEERSERWKSFLELQAESAQLPAVGLSKEQDNKALL
SEASEHEPDSNSEKGVDGDDLSDQKAGSDSLTKNDNEKEELEAKDTKTHGIQIWNEIRPSLHAIETMMSVRIKKKNNLSK
HEQDTGTGKPLTPLEEARSPKGASEEDSEDEFYDVERSDQDVLSSDSVSASATGAASDTVPSESLFPWKEELEVLVRGGV
PMALRGELWQAFVGVKARRVDNYYKDLLASETNAGNNVELNSLDSDRNSKLSATDSVCAPEKWKGQIEKDLPRTFPGHPA
LDEDGRNALRRLLTAYARHNPSVGYCQAMNFFAGLLLLLMPEENAFWALMGIIDDYFDGYYSEEMIESQVDQLVFEELVH
ERFPRLVNHLDYLGVQVAWVSGPWFLTIFMNMLPWESVLRVWDVLLFEGNRVMLFRTALALMELYGPALVTTKDAGDAVT
LLQSLAGSTFDSSQLVLTACMGYQNVNETRLQELRNKHRPAVLIAIEERSKGLRAWKDSQGLASKLFNFKQDPKSMIIET
KKGERLVDAQTNGDLSRSESGSNNADLISLNGDGEVESVPDLQEQVVWLKVELCKLLEEKRSAELRAEELETALMEMVKQ
DNRRQLSARVEQLEQEVAELRQALSDKQEQESVMLQVLMRVEQEQRLTEDARRFSEQDAAAQRYAAQVLQEKYEEATAAL
AEMEKRVVMAESMLEATLQYQSGQQKTQPSPRSLSLPVQTNQDQTQEFPARKISLLSRPFGLGWRDRNKGKPANNEEPND
SKSISEGQSPTAEVKETNGLQVEDKE*

DNA
ATGAAATCCGCCACCAAAGTCTCTCTCAACCCGCTTGTCGCCTACGAGCACAAGAGGGATGCTTATGGATTTGCTGTGAG
ACCTCAGCATGTACAACGATACCGAGAATATGCCACTATCTACAAGGAAGAAGAGGAGGAAAGATCAGAAAGGTGGAAGT
CTTTCCTGGAACTACAAGCAGAGTCCGCTCAATTGCCTGCAGTTGGATTATCTAAGGAACAAGATAACAAGGCCTTGCTT
TCTGAAGCCTCAGAGCATGAACCAGACTCCAATTCGGAGAAGGGTGTTGATGGTGATGATTTAAGTGACCAGAAGGCAGG
TTCTGATTCTCTGACCAAAAATGATAACGAAAAGGAGGAACTGGAAGCTAAGGACACAAAAACTCATGGGATTCAAATAT
GGAATGAAATTAGACCATCTCTTCACGCCATTGAGACCATGATGAGTGTTCGTATAAAGAAGAAGAACAATTTGTCAAAG
CATGAGCAGGACACAGGAACTGGGAAGCCGCTTACTCCTCTTGAAGAGGCTAGATCCCCAAAAGGAGCATCTGAGGAGGA
CTCCGAGGATGAGTTCTATGATGTGGAGAGGTCAGACCAGGATGTCCTTTCAAGTGACAGTGTGAGTGCATCTGCAACAG
GTGCTGCTTCTGACACTGTCCCTTCAGAATCTTTATTTCCTTGGAAAGAAGAGTTGGAGGTTCTTGTTCGTGGGGGAGTA
CCAATGGCTCTCAGGGGAGAGCTCTGGCAAGCTTTTGTTGGTGTGAAGGCACGGCGTGTGGATAACTATTACAAGGATCT
GCTAGCTTCAGAAACTAATGCTGGTAATAATGTGGAACTAAATAGCTTGGACTCAGACAGAAATAGCAAGTTGTCAGCAA
CAGATTCTGTATGTGCACCTGAAAAATGGAAAGGGCAGATTGAGAAGGATCTACCTAGAACATTTCCAGGTCACCCTGCT
CTAGATGAAGATGGTAGAAATGCTTTGAGGCGTTTGCTTACCGCATATGCGCGGCATAATCCCTCTGTTGGGTACTGTCA
GGCCATGAATTTCTTTGCTGGCTTATTACTGCTTCTCATGCCCGAAGAAAATGCCTTCTGGGCTTTGATGGGGATTATTG
ATGATTATTTTGATGGCTATTACTCTGAGGAAATGATAGAATCTCAGGTGGATCAACTTGTTTTTGAAGAGTTGGTGCAT
GAGAGATTTCCTAGATTGGTCAATCATCTAGATTACCTGGGAGTGCAGGTGGCATGGGTTAGTGGACCATGGTTCCTTAC
CATCTTCATGAACATGCTTCCATGGGAAAGTGTTCTTCGAGTCTGGGATGTGCTTCTTTTTGAAGGAAACCGCGTTATGC
TATTTAGAACAGCACTTGCTTTGATGGAGTTATATGGCCCTGCACTGGTTACTACCAAGGATGCTGGAGATGCAGTTACT
CTGCTGCAATCACTGGCTGGCTCTACATTTGATAGCAGTCAACTGGTATTGACAGCTTGCATGGGTTACCAAAATGTAAA
TGAAACTAGATTACAAGAGTTGAGAAATAAACATCGGCCAGCTGTACTTATTGCTATCGAGGAAAGATCGAAGGGACTTC
GGGCGTGGAAGGATTCTCAAGGTCTAGCATCTAAGCTGTTTAATTTCAAGCAAGATCCTAAATCAATGATAATTGAGACA
AAGAAAGGAGAACGACTAGTCGATGCACAGACAAATGGTGATTTATCACGTTCAGAGTCTGGGTCCAATAATGCAGATCT
TATTAGCCTGAATGGGGATGGGGAGGTAGAGTCTGTACCAGATCTTCAAGAACAGGTGGTATGGTTGAAGGTTGAATTAT
GCAAGCTGCTGGAGGAGAAAAGATCTGCTGAACTCAGAGCCGAGGAGCTGGAGACAGCATTGATGGAGATGGTCAAGCAA
GATAATCGTCGGCAATTGAGTGCCAGGGTTGAGCAATTAGAGCAAGAGGTTGCTGAGCTTCGCCAAGCCCTTTCTGATAA
GCAGGAACAGGAGAGTGTCATGCTCCAGGTCTTAATGCGAGTAGAGCAAGAGCAGAGACTAACAGAAGATGCTCGGAGAT
TTTCTGAGCAAGATGCAGCAGCACAGAGATATGCTGCTCAAGTGCTTCAGGAGAAGTATGAAGAGGCCACAGCTGCACTT
GCTGAAATGGAAAAGAGAGTTGTTATGGCAGAATCAATGTTGGAGGCTACTTTGCAATACCAATCCGGTCAACAGAAAAC
ACAACCTTCTCCACGATCTCTATCTTTACCTGTACAAACCAATCAAGACCAGACACAAGAGTTCCCTGCAAGAAAGATCA
GTTTGCTATCTCGACCATTTGGCCTTGGCTGGCGTGATCGCAACAAGGGAAAACCTGCTAACAATGAGGAGCCAAATGAC
AGCAAGTCTATCAGTGAGGGACAGAGTCCCACCGCAGAGGTAAAAGAGACGAATGGCCTTCAAGTGGAAGATAAAGAGTA
G