Details for Peach Locus ppa001402m

Position : sca2 ( 5`- 21823270 .. 21826346 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa001402m

Protein [Map View]
MVSKEDASATSRPPAQLSSSRKMFWRSASWSASRTTPHNPETEEKDLADPNATVGNSVQNHRRFPVPLTPRSQQNSKARS
CLPPLQLPLARRSLDEWPKAGSDDIGEWPQPPTPSGRGGGERLKLDLSTIQRNPEKNGGLVRRDKIAFFDKECSKVAEHI
YLGGDAVARDRDILKQNGITHVLNCVGFVCPEYFKADFVYRTLWLQDSPTEDITSILYDVFDYFEDVREQGGRVFVHCCQ
GVSRSTSLVIAYLMWREGQSFDDAFQYVKAARGIADPNMGFACQLLQCQKRVHAFPLSPSSLLRMYRIAPHSPYDPLHLV
PKMLNDPSPSALDSRGAFIVHIPSAIYVWIGKNCEAIMERDARGAVCQIVRYERVQGPITIIKEGEEPAYFWDAFSNILP
LMDRSGNGGEVGESTVKIRPGARKTDGYNVDFEIFQKAIRGGFVPPFASSENEHETHLPARESSWSMLRRKFASGSMKEF
VLAPRISLSRVYSDSMMLVHTAKTNSSASSSSSSSSSSSPLYLSPDSISSESSTSSKYFSESSMDSPSAASCSLPVSSTL
SNDSDVSLLSPKSSDQPMSNSPENVVSNCSSQSYSRSTSLPSKKLSSLAERRGSLSLKLPVMSDKMRLMCTSSKFLSTKE
DGVRINDSTCSVGHLDDIDKVLEPKDGVQNGGEDSRQQCNICQKEPSFIKHSAEPWKNCPLEEGAGSSASKETGESCRAQ
CNFMQPFVCRWPSLEKIATFGVRELDSKSAFTIYSPNTGVGKSEDSVLYLWVGRFFHCGNFPIQLDSGRERTDVEETDWD
QVSCDVLIQMGMPKDTIIKIVKENEEPVEFLELLSLL*

DNA
ATGGTGAGTAAGGAGGATGCCTCCGCTACTTCACGGCCTCCGGCCCAGCTTTCAAGCTCTCGGAAGATGTTCTGGCGCTC
AGCATCATGGTCTGCTTCACGGACCACCCCTCACAACCCTGAGACTGAGGAAAAAGACCTAGCAGATCCAAATGCCACTG
TAGGAAACAGTGTCCAAAACCACCGTAGGTTTCCTGTGCCTTTAACCCCTCGGTCCCAGCAGAATAGCAAGGCTAGGTCT
TGTTTGCCCCCCTTGCAATTACCTCTTGCTCGACGTAGCTTAGATGAGTGGCCCAAGGCGGGTTCGGATGATATTGGTGA
GTGGCCACAACCTCCTACCCCAAGTGGAAGAGGTGGTGGGGAGAGGTTGAAGCTTGATTTATCAACAATTCAGCGAAACC
CGGAAAAGAATGGTGGGCTTGTGAGGAGGGATAAGATTGCTTTCTTTGATAAAGAGTGTTCCAAAGTGGCCGAACACATT
TATCTTGGCGGAGATGCGGTTGCGAGGGATAGGGACATACTTAAGCAGAATGGGATTACTCATGTTCTAAATTGTGTGGG
TTTTGTTTGTCCCGAGTATTTCAAGGCGGATTTTGTGTATAGAACTCTATGGTTGCAGGACAGTCCGACCGAGGACATTA
CTAGTATCTTATATGATGTTTTTGATTACTTTGAAGATGTTAGGGAACAAGGTGGAAGAGTTTTTGTTCATTGTTGTCAA
GGGGTATCTCGGTCCACCTCATTGGTGATTGCGTATCTTATGTGGAGAGAAGGACAGAGTTTTGATGATGCATTTCAGTA
TGTGAAAGCAGCAAGAGGCATTGCTGATCCGAATATGGGTTTTGCTTGTCAGTTGTTACAGTGCCAAAAGAGGGTCCATG
CTTTTCCTCTTAGCCCGAGTTCACTATTGAGGATGTACAGAATTGCCCCACATTCACCGTATGATCCTTTGCATCTTGTC
CCAAAAATGTTGAATGATCCATCACCTTCTGCTCTGGATTCTAGAGGTGCATTTATTGTTCATATACCGTCTGCCATATA
TGTTTGGATTGGTAAGAATTGTGAGGCCATCATGGAAAGGGATGCAAGAGGAGCTGTTTGTCAGATTGTTCGGTATGAGA
GAGTGCAAGGTCCAATAACTATAATCAAGGAAGGGGAAGAACCAGCTTACTTTTGGGATGCTTTCTCAAACATTTTGCCA
TTGATGGATAGGTCTGGCAATGGAGGGGAGGTTGGGGAATCAACAGTCAAGATTCGTCCAGGTGCAAGGAAAACAGACGG
ATATAATGTTGATTTTGAAATTTTCCAGAAAGCTATTAGGGGGGGTTTTGTACCTCCATTTGCATCCTCCGAGAATGAAC
ACGAAACCCATCTTCCTGCTAGGGAGAGTAGCTGGAGTATGCTCAGGCGTAAGTTTGCCTCTGGCAGTATGAAGGAGTTT
GTCTTAGCACCCAGGATATCCCTCTCCAGGGTCTATTCAGATTCTATGATGTTAGTTCATACAGCTAAAACTAATTCATC
AGCGTCGTCTTCATCTTCATCGTCCTCTTCTTCTTCACCTCTATATCTATCACCAGATTCCATATCTTCTGAATCAAGCA
CTAGTTCGAAGTACTTTTCAGAATCCTCTATGGATTCGCCATCAGCAGCTTCATGCTCTCTTCCAGTCTCTTCCACATTG
TCAAATGATTCTGACGTGTCTCTCCTCTCACCTAAATCTTCTGATCAACCCATGTCTAACAGTCCAGAAAACGTTGTTTC
CAATTGTAGTTCACAGTCCTATTCCCGATCAACCTCATTACCATCAAAAAAGTTATCTTCGCTTGCAGAGCGCAGAGGTA
GTTTGTCTCTCAAGTTGCCTGTGATGAGTGATAAGATGAGGCTGATGTGTACTTCCTCAAAATTTCTTTCCACTAAAGAA
GATGGTGTTAGGATAAATGACAGTACTTGTTCCGTAGGTCACTTAGATGATATTGACAAGGTATTAGAGCCAAAGGATGG
TGTTCAAAATGGAGGGGAAGATTCAAGACAACAGTGCAACATATGCCAGAAGGAACCTTCTTTTATCAAACATTCTGCTG
AACCTTGGAAAAATTGCCCTTTGGAAGAAGGTGCAGGATCCTCTGCCTCAAAGGAGACTGGGGAAAGTTGTCGAGCACAA
TGTAATTTTATGCAACCTTTTGTATGCCGCTGGCCCAGTTTAGAGAAGATTGCTACATTTGGTGTGAGGGAACTAGATTC
TAAATCTGCTTTCACTATTTACTCACCAAATACAGGTGTTGGAAAAAGTGAAGACAGTGTTTTGTATCTTTGGGTAGGAA
GATTTTTTCACTGTGGTAATTTTCCGATTCAATTAGATAGTGGCAGAGAGAGAACTGATGTAGAAGAGACTGACTGGGAT
CAAGTTAGCTGTGATGTCCTTATCCAAATGGGTATGCCAAAGGACACTATAATTAAGATTGTTAAAGAAAATGAAGAACC
AGTGGAGTTTCTTGAATTGTTGAGTCTATTGTAG