Details for Peach Locus ppa001357m

Position : sca2 ( 5`- 22479863 .. 22486984 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001357m

Protein [Map View]
MSLTTIFLLLLYFSLFTFLTTHSKPHLPSPYLSPTTIFPNYQNMLKSFKIFIYNPNTPFTFNSPSQSLFYTTLTLQDSVF
VTQDAEQAQLFFVPFPSDLSTRSIARLIRGLRNDLPYWNRTLGADHFYLSCAGIGYESDRNLVELKKNSIQISCFPTPAG
KFIPHKDISLPPLASSHAPTNKTTRFLGYARFNWLKESTLVNELSSDPEFLIESEPSDLNSYAERIASSKFCLFEYGGGD
VSGIGEALRFGCVPAVVTDRPIQDLPFSDVLRWQEIAVFVERRGVGELKRVLARTCGDRHEKMKGLGVTASGDGSSKPTP
YEEALDALSSLITKRSRADTSNNGDCFELLSDYLKILELDEPISQLKIIHVAGTKGKGSTCTFTESILRHCGFRTGLFTS
PHLIDVRERFRLDGVDISEEKFLAYFWWCFERLKEKASDGIPMPSYFRFLALLAFKIFAAEEVDVAILEVGLGGKYDATN
VVKAPVVCGVSSLGYDHMEILGNTLGAIAGEKAGIFKPGVPALTVPQPDEAMCVLEEKASELNVPLQLVRPLDANLLNGF
KLGLEGEHQYVNAGLAIALSSTWLQRTGHLEVPYPEHTTSLPEQFIKGLTATVSLQGRAQIVPDNNESPEDLVFYLDGAH
SPESMEICARWFSLSIKGDSQEKILSCQPLDASRSSHDLVQRKPDGKSRKNSTQILLFNCMSVRDPQLLLPNLMKTCASH
GVYFKKALFVPNTSVYNKVGSHSLPATDSQVDLSWQFALQRVWENLMLGDKAGGDEKSTGAVFEELTDDTEMAVRSCENS
AVFPSLPSAIKWLRDSVRKSQSVRFQVLVTGSLHLIGDVLKLIKK*

DNA
ATGTCACTCACCACCATTTTCCTCCTCCTCCTCTACTTCTCTCTCTTCACCTTCCTCACCACTCACTCCAAACCCCATCT
CCCTTCCCCATACCTCTCACCCACCACAATCTTCCCAAACTACCAAAACATGCTCAAATCTTTCAAAATCTTCATCTACA
ACCCTAACACGCCCTTCACCTTCAACTCTCCATCTCAGTCCCTCTTCTACACCACTCTGACTCTCCAAGATAGCGTCTTC
GTCACTCAAGACGCTGAGCAAGCCCAGCTCTTCTTCGTCCCCTTCCCTTCCGATCTCTCCACGCGCTCCATCGCGCGTCT
CATCAGAGGCCTTCGCAATGATCTTCCCTACTGGAACCGCACCCTCGGAGCTGACCATTTTTACCTGTCCTGTGCGGGTA
TCGGGTACGAATCGGACCGAAATCTCGTTGAGCTCAAGAAAAACTCGATCCAGATCTCGTGCTTTCCGACGCCGGCCGGT
AAGTTCATACCTCACAAGGACATTTCCCTCCCTCCGCTCGCGAGCTCTCACGCACCAACAAACAAAACGACGAGGTTTTT
GGGCTATGCCAGGTTCAATTGGCTAAAGGAGTCAACGTTGGTCAACGAATTGAGCAGCGACCCGGAGTTTCTGATCGAAT
CCGAACCGTCGGATCTGAATTCTTATGCGGAGAGAATCGCCAGCAGTAAGTTCTGTTTGTTCGAGTATGGAGGAGGCGAT
GTTTCGGGTATCGGCGAGGCGTTGCGTTTCGGGTGTGTGCCCGCGGTGGTTACTGACCGTCCGATCCAGGACCTGCCGTT
CTCGGACGTGCTGAGGTGGCAGGAGATCGCGGTATTCGTGGAACGTAGAGGGGTTGGGGAACTAAAGCGTGTGCTGGCTC
GCACGTGCGGGGACCGGCATGAGAAAATGAAGGGGTTGGGCGTGACTGCGAGTGGCGATGGCTCTTCGAAACCAACTCCT
TATGAAGAGGCATTGGATGCTTTGTCCTCTTTAATCACAAAACGCAGTCGTGCCGATACGAGCAACAACGGGGACTGCTT
CGAACTGCTATCTGACTATCTCAAAATATTGGAGTTAGACGAGCCAATTTCACAGTTGAAGATTATTCATGTGGCTGGCA
CCAAAGGAAAGGGATCTACCTGCACCTTCACAGAATCAATATTACGCCATTGTGGCTTTCGCACAGGACTTTTCACATCT
CCTCATCTCATTGATGTTCGAGAAAGATTTCGTTTGGATGGTGTGGACATCAGCGAAGAGAAATTTTTAGCATATTTCTG
GTGGTGTTTTGAGAGACTAAAGGAAAAAGCTAGTGATGGTATACCAATGCCTTCCTACTTTCGCTTCCTTGCCTTGCTTG
CCTTCAAGATATTTGCTGCAGAAGAGGTAGATGTTGCTATCTTGGAGGTTGGGTTAGGTGGAAAGTATGATGCAACAAAT
GTGGTTAAGGCACCTGTTGTTTGTGGTGTATCTTCCCTTGGATATGACCACATGGAGATTCTTGGAAATACTCTGGGAGC
AATTGCTGGGGAGAAGGCTGGAATCTTCAAGCCTGGGGTTCCTGCCTTGACTGTGCCCCAACCTGATGAAGCAATGTGTG
TACTGGAAGAGAAGGCTTCTGAGTTGAATGTACCTCTTCAACTGGTACGACCTTTGGATGCCAATTTGCTGAATGGCTTC
AAACTTGGGCTTGAAGGGGAGCACCAATATGTTAATGCTGGTCTCGCTATTGCACTGTCCTCTACGTGGCTTCAGAGGAC
AGGTCATCTTGAAGTCCCATACCCAGAACATACTACCTCTCTGCCAGAGCAGTTCATAAAAGGACTAACTGCTACAGTCA
GTTTACAAGGACGGGCTCAAATTGTCCCCGATAACAATGAAAGCCCTGAAGATCTTGTGTTCTATTTGGATGGTGCCCAT
AGCCCAGAAAGCATGGAAATATGCGCAAGATGGTTTTCTCTTTCCATTAAGGGTGACTCCCAGGAAAAAATCTTGAGTTG
TCAGCCACTGGATGCTTCCAGATCATCACATGATTTGGTACAGAGGAAACCTGATGGAAAATCCAGGAAGAATTCAACAC
AGATACTGCTGTTTAATTGTATGTCAGTGAGGGATCCTCAGTTGCTTCTTCCGAACCTGATGAAAACATGTGCTAGTCAT
GGTGTCTACTTCAAGAAGGCTCTATTTGTACCAAACACATCAGTGTATAACAAGGTGGGTTCGCATTCCTTACCTGCGAC
TGATTCTCAAGTTGATTTGTCATGGCAGTTCGCGCTTCAAAGAGTTTGGGAAAACCTAATGCTGGGTGACAAAGCAGGAG
GTGATGAGAAGAGCACAGGCGCTGTTTTTGAAGAACTAACAGATGATACGGAAATGGCTGTCAGAAGTTGTGAAAATAGT
GCAGTCTTCCCCTCTCTCCCGTCAGCTATAAAATGGCTCAGGGACAGTGTCCGAAAAAGTCAGTCTGTTCGTTTTCAGGT
CCTCGTAACTGGTTCTTTACATCTCATCGGTGATGTGTTGAAATTAATCAAGAAGTGA