Details for Peach Locus ppa001349m

Position : sca2 ( 5`- 23336388 .. 23333747 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001349m

Protein [Map View]
MDYPFQTFQFLKKGVSDWRRILHKKKEKWKILHSKCTHFIFFLQLLFCALQPVRSEIWDGVIVTAADYQALQAIKHELDD
PKGFLRSWNDSGFGACSGGWAGIKCAQGQVIVLQLPWKGLGGRISEKIGQFQALRKLSLHDNQIEGPIPQSLGFLPSLRG
VQLFNNRLSGSIPPSLGFSPLLQTLDLSNNSLTDKIPDSLANSTKLYRLNLSYNSFSGSVPVSFTHSHSLTFLALQHNNL
SGPVPDSWGSTGTQNSHLFRLQSLTLDHNFLSGSIPASLGKLSELEEVSISGNHFSGAIPNEIGSLSRLRTLDFSNNAIN
GSLPSSISNLSLLVQLNLEGNKLDSKIPEGLGSLKNLSVLNLRKNQLQGPIPAALGNISTLTQLDLSLNNLSDGIPASLA
DLPHLSFLNVSDNNLSGPVPALLSHKFNASSFGNTQLCGYSASTPCPSEAPSQSVQAPAPEVSKRHRKLSTKDKILIAAG
ALLLVLFVLCCILLCCLIRRRSASKAKDGQGTAGAGAARTEKGVPAVAGEVESGGEAGGKLVHFDGPMAFTADDLLCATA
EIMGKSTFGTVYKATLEDGSEVAVKRLREKITKSQREFEAEVNILGKIRHPNLLALRAYYLGPKGEKLLVFDYMPKGSLA
AFLHARGPDTPIDWPTRMNIAKGMARGLSYLHTNENIIHGNLTSSNILLDEQTNARISDYGLSRLMTAAANSNVIATAGA
LGYRAPELSKLKKANTKTDVYSLGVIILELLTGKSPGEPMNGLDLPQWVASIVKEEWTNEVFDLELMRDASIIGDELLNT
LKLALHCVDPSPSARPEVQQVLQQLEEIRPETAASSSDDGAGAPSASE*

DNA
ATGGATTACCCATTTCAGACTTTTCAGTTTCTCAAAAAAGGAGTCTCTGATTGGCGCCGGATTTTACATAAGAAGAAAGA
AAAATGGAAGATCCTTCATTCCAAATGCACCCATTTTATCTTCTTTCTTCAGCTCCTGTTCTGTGCCCTCCAGCCAGTCA
GAAGCGAAATCTGGGATGGTGTCATTGTCACAGCAGCTGATTACCAAGCTCTTCAAGCTATCAAGCACGAGCTAGATGAC
CCAAAAGGGTTCTTGAGGAGCTGGAATGACAGCGGCTTTGGAGCTTGCTCCGGTGGCTGGGCTGGAATCAAGTGTGCTCA
GGGGCAGGTTATTGTGCTCCAGCTTCCATGGAAGGGATTGGGTGGCAGAATCTCAGAGAAAATAGGCCAGTTTCAGGCGC
TTCGAAAGCTCAGCCTCCACGACAACCAGATTGAGGGTCCAATTCCTCAGTCGCTGGGCTTCCTTCCAAGCCTCAGAGGA
GTTCAACTATTCAACAACAGACTCTCTGGTTCAATTCCTCCTTCATTGGGTTTTAGTCCTCTGCTTCAGACCCTTGATCT
TAGCAACAACTCTCTCACTGACAAAATCCCAGATAGTCTTGCAAACTCTACCAAGCTTTACAGGCTCAATCTCAGCTACA
ATTCATTTTCTGGCTCTGTCCCAGTTAGTTTCACTCACTCACATTCTCTTACCTTCCTTGCTCTGCAACACAACAATCTC
TCTGGTCCTGTCCCAGACTCATGGGGCAGCACTGGAACACAAAACAGTCACTTATTTAGACTTCAGTCCTTGACCCTTGA
CCATAACTTCCTCTCAGGAAGTATCCCTGCTTCTTTAGGCAAGTTAAGTGAGCTTGAAGAGGTTTCTATTAGTGGTAACC
ACTTCAGTGGAGCCATACCAAATGAAATAGGGAGCCTCTCTAGGCTTAGAACACTAGATTTTTCTAATAATGCCATCAAT
GGAAGCTTGCCTTCTAGTATCTCTAATCTCTCCTTACTTGTTCAGCTAAATCTGGAGGGAAACAAACTTGACAGCAAAAT
CCCAGAAGGTCTTGGCAGTTTGAAAAACCTTTCTGTTCTCAACTTGAGGAAAAACCAATTGCAGGGTCCAATTCCTGCAG
CTCTTGGAAACATTTCCACACTTACCCAACTTGACTTGTCACTAAATAATCTCAGTGATGGAATTCCAGCTTCTCTTGCT
GATCTACCACATCTTAGCTTCCTCAATGTTTCTGACAATAACCTCTCTGGTCCTGTCCCAGCTCTTCTCTCCCATAAATT
CAATGCAAGCTCTTTTGGGAACACTCAGCTATGTGGGTACAGTGCTTCAACCCCATGCCCATCTGAAGCACCATCTCAAA
GTGTCCAAGCTCCAGCCCCTGAGGTTTCGAAACGCCACCGCAAGCTAAGCACCAAAGACAAAATTCTTATAGCAGCAGGA
GCTCTTCTATTAGTATTGTTTGTACTTTGTTGCATACTTCTCTGCTGTTTGATAAGAAGAAGATCTGCATCAAAAGCCAA
GGATGGCCAGGGTACAGCCGGAGCCGGAGCTGCAAGGACCGAAAAGGGGGTCCCAGCTGTTGCTGGTGAAGTTGAATCGG
GTGGAGAGGCTGGAGGAAAGCTAGTACACTTTGATGGGCCAATGGCTTTCACAGCAGATGATCTTCTGTGTGCAACAGCA
GAGATTATGGGGAAGAGCACTTTTGGGACTGTCTACAAGGCCACACTGGAGGATGGGAGTGAAGTTGCAGTGAAGAGATT
GAGAGAAAAGATAACCAAAAGTCAGAGGGAGTTTGAGGCAGAAGTGAATATACTTGGGAAAATCAGACATCCAAATCTTC
TGGCACTGAGGGCCTATTACTTGGGACCTAAAGGAGAAAAGCTTCTGGTTTTCGATTACATGCCTAAAGGAAGTCTTGCA
GCATTTCTCCATGCTCGAGGTCCTGATACTCCCATTGATTGGCCAACAAGAATGAACATAGCAAAGGGCATGGCAAGAGG
CCTGTCCTACCTCCACACCAATGAGAACATTATACATGGGAACCTCACATCCAGCAATATTCTACTTGATGAGCAGACCA
ATGCTAGGATCTCAGATTATGGCCTCTCTCGCCTCATGACCGCAGCTGCCAATTCAAATGTGATTGCAACTGCCGGAGCA
CTAGGGTACCGAGCACCGGAGCTCTCAAAGCTTAAGAAGGCCAACACAAAAACGGACGTATACAGCCTTGGGGTGATCAT
ATTGGAACTCCTAACAGGGAAGTCTCCTGGTGAGCCAATGAATGGCTTGGATTTGCCTCAATGGGTGGCCTCCATTGTGA
AAGAGGAGTGGACTAACGAAGTTTTCGATTTGGAATTGATGAGGGATGCATCAATTATCGGTGACGAGCTGCTAAACACA
TTGAAACTAGCCTTGCATTGTGTTGATCCTTCACCATCTGCAAGACCAGAAGTTCAACAGGTTCTGCAGCAACTAGAGGA
GATTAGACCCGAAACAGCTGCCAGTTCCAGTGACGATGGAGCTGGAGCCCCTTCAGCAAGTGAGTGA