Details for Peach Locus ppa001281m

Position : sca2 ( 5`- 23112607 .. 23106496 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001281m

Protein [Map View]
MARTTPILNHNNTHLLFTFKTPNSHFSSLSSLRLTKHPFSLSPSSLSCSPSCCITRVTTVPVEYAPSAPDFDFHQELSRL
KTLRSRLADSNSLRAKLRVIEGDPRVKRFFNSSNNGFSTVLASLNLTPYELFLFKCLVAAGQEHVLGWGFEFVQSEMESV
RSSVKSALYALVSMIEKLDVNGEGSGENIGRVALNDEDFKDLKKLLKNLGEIEQFYNCIGGIIGYQIAVLELLAQSSVEM
QTTNWSKSIQEHMECQFLEIHAPSGLDLSQNPEYASQAALWGIQGLPNLGEIYPLGGSADRLGLVDPDTGECLPAAMLPY
CGRTLLEGLIRDLQAREFLYFKMYGKQCITPVAIMTSSAKNNHERITSLCEKLEWFRRGRSNFLLFEQPVVPAVSVENGQ
WVIMKPFAPICKPGGHGVIWKLAHDKGIFKWFYDHGRKGATVRQVSNVVAATDLTLLALAGIGLHHGKKLGFASCKRNLG
ATEGINVLIEKKNLDGRWAYGLSCIEYTEFDKFGIADGPHSRNRLQAEFPANTNILYVDLPSAELVGSSNSGNSLPGMVL
NVKKPITFVDHFGKPHSVSGGRLECTMQNIADSFVNTCPSRYYKGVEDKLDTFVVFNKRRRVTSSAKRKRRLADKSLHQT
PDGSLLDILRNAHDLLSQCDIELPEIESNEKYLSSGPPFLILLHPALGPLWEVTRQKFYEGSISKGSELQVEVAEFLWRN
VQLDGSLIIEADNIMGSTKIDQNGEPLLQYGHRCGRCKLQNVKVLNEGIDWTFGDNVYWKHDVQRIEACKVVLHGNAEFE
ATDVILQGNHIFEVPNSYKMKITQGDSGLVVRLDPIEQNMMDSGSWYWEYSIKGTHIQLEMVEL*

DNA
ATGGCGCGCACAACTCCAATACTTAACCACAACAACACACACTTGCTCTTCACCTTCAAAACTCCAAACTCTCATTTCAG
CTCTCTCAGCTCTCTCCGCCTCACCAAACACCCATTCTCACTTTCTCCTTCTTCTTTATCGTGCTCGCCTTCTTGTTGTA
TTACGCGCGTAACCACTGTGCCAGTAGAGTACGCGCCGTCAGCTCCCGATTTTGATTTTCACCAAGAGCTCTCGCGCCTC
AAGACACTCCGTTCCAGGCTCGCCGACTCCAATTCCCTCCGCGCCAAGCTCAGAGTGATCGAGGGCGATCCCAGAGTGAA
GCGGTTCTTCAATTCAAGCAACAATGGCTTCTCTACGGTTTTAGCTTCTCTCAATTTGACTCCTTACGAGTTGTTTTTGT
TCAAGTGCTTGGTTGCAGCGGGGCAAGAGCACGTGCTCGGTTGGGGTTTTGAGTTCGTCCAGAGCGAGATGGAATCGGTG
AGGAGCTCGGTGAAGAGCGCGCTTTATGCGCTCGTCTCAATGATTGAGAAATTGGATGTGAATGGCGAGGGTTCGGGGGA
GAACATTGGTCGCGTGGCTTTGAATGATGAAGATTTTAAGGACTTGAAGAAGCTCTTAAAGAATTTGGGAGAAATTGAAC
AGTTCTATAACTGCATTGGTGGAATTATAGGATATCAGATAGCGGTATTGGAGCTTCTAGCCCAATCAAGTGTTGAAATG
CAGACTACAAACTGGTCAAAGAGCATACAAGAGCACATGGAATGCCAGTTTTTGGAAATTCACGCTCCTAGTGGACTTGA
TCTTTCTCAAAATCCAGAATATGCATCCCAAGCTGCTTTATGGGGAATTCAGGGTTTGCCAAACCTAGGTGAAATCTATC
CTTTGGGAGGCTCCGCAGACAGGCTTGGTTTGGTTGATCCTGACACAGGTGAATGTCTCCCTGCTGCAATGCTTCCTTAT
TGTGGACGGACTTTATTGGAAGGTCTTATAAGAGATCTTCAGGCTAGAGAGTTCCTGTACTTCAAGATGTATGGGAAACA
ATGCATCACTCCTGTCGCAATCATGACAAGCTCTGCAAAGAACAACCATGAACGCATAACTTCTCTTTGTGAAAAACTTG
AATGGTTTCGAAGAGGTCGATCAAATTTCCTACTTTTTGAACAGCCCGTTGTTCCAGCTGTTAGTGTCGAGAATGGGCAG
TGGGTAATCATGAAACCTTTTGCACCCATATGCAAGCCTGGTGGTCATGGGGTGATATGGAAACTTGCTCATGATAAAGG
TATTTTCAAATGGTTTTATGATCATGGACGGAAGGGTGCAACTGTACGACAAGTTAGCAATGTTGTGGCGGCTACAGATT
TGACCCTTTTGGCACTGGCTGGGATTGGCTTACACCATGGAAAGAAACTGGGGTTTGCCTCCTGTAAGAGGAACTTGGGT
GCTACAGAAGGAATTAATGTTTTAATTGAGAAAAAAAATCTTGATGGAAGGTGGGCATATGGTTTGTCGTGCATCGAGTA
CACAGAGTTTGACAAGTTTGGGATAGCAGATGGACCTCATTCTCGTAATAGGTTGCAGGCAGAGTTCCCCGCCAATACAA
ACATCTTATATGTAGATTTGCCTTCAGCAGAGTTGGTTGGGTCAAGTAATAGTGGAAACAGCTTACCAGGCATGGTGCTG
AATGTTAAAAAGCCAATAACATTTGTAGACCATTTTGGAAAACCACACAGTGTCTCTGGTGGAAGACTTGAATGCACGAT
GCAAAATATTGCTGACAGCTTTGTTAATACATGTCCATCTCGATATTATAAGGGTGTTGAAGATAAGCTCGATACTTTTG
TTGTTTTTAATAAACGAAGAAGGGTCACGTCATCTGCTAAGAGGAAAAGAAGACTTGCAGACAAATCTTTACACCAAACT
CCTGATGGTTCACTGTTGGATATCCTACGGAATGCCCATGATCTTCTTTCGCAGTGTGATATTGAACTTCCTGAGATTGA
AAGCAATGAGAAGTATTTAAGTTCTGGACCACCATTTCTTATCCTTCTGCATCCTGCTCTTGGCCCACTTTGGGAGGTCA
CCAGACAAAAATTCTATGAAGGCTCAATATCCAAGGGCTCTGAGTTACAAGTAGAGGTTGCAGAGTTTCTCTGGAGGAAT
GTTCAGCTTGATGGAAGCCTGATCATAGAGGCTGACAACATTATGGGCTCAACTAAGATTGATCAAAATGGTGAACCCCT
TTTACAATATGGACACAGGTGTGGAAGATGTAAATTACAGAATGTCAAAGTATTGAATGAGGGAATTGACTGGACTTTTG
GAGACAATGTATACTGGAAGCATGATGTTCAACGCATCGAGGCATGTAAGGTCGTACTGCATGGAAATGCTGAATTTGAG
GCAACTGATGTAATCTTACAGGGAAATCATATATTTGAAGTTCCAAATTCCTACAAAATGAAGATCACACAAGGAGATTC
AGGTTTAGTGGTCCGATTAGATCCTATTGAACAGAACATGATGGATAGTGGAAGCTGGTACTGGGAATACAGCATAAAGG
GCACACACATTCAGTTGGAGATGGTAGAGTTGTAA