Details for Peach Locus ppa001067m

Position : sca2 ( 5`- 21404692 .. 21401085 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa001067m

Protein [Map View]
MKKLFFFRSSASSNGNNNVSPSTDKQIYWENPSEDGNQVGDMAENSFRSPKGFFSKSRKQVTDIQNSSKSPGLRRSRSLS
SAAFLGNEPAQNNFSSSRYQSRSPCSPASSVPHQQCGQSSWTLTPERYEAKPVEVPAVQNTHGLERPCSAGSSRIHRDSS
GSSSTCSSNISSKVLDRYIDGEQEERGRQKNNSSSRNLCGNGNGGGFRPPRAQFTAPNSPRAHSFREAKSSRFRLSSRDW
AENGFGHESPRRLAKNVVERLSQSHGIQPTHEKEFDHDMPVTIEDIYGRSDLVAQKNYHGDDYSSLQKLIYGDNCDGLNT
DETQEDMDVELERRLKEAEENVMLLSEELEQESFLRDSGYNVQQTVRNLTDQRIDLALEVSNLLQLRIAERASAKKELRL
AKGELESRTKKLEKEKNELQSALERELDRRSTDWSLKLEKYQLEEQRLRERVRELAEQNVSLQREVSSFNARETESRSVI
TNSEQQLKGLTTRLGETREENQDLKNNLSDLQEKYRAAEENRVCIHKSFEEKDKECKDLRKSITRLLRTCKEQEKTIDGL
REGFGEEFRKNQSLERVDKHISKLQMEQIRLTGVELALRRELESHRLEVDSLRHENIHLLDRLRGSGKENGALTFKLDKE
MWTRICCLQNQGLSILNESSQLCSNLLEFAKGKAGQLPESKNGLDGQFFVESEMKVQGLKRGTESLARSLHTMSALLHEK
SSLASSKYPSKCINADGSPNDQNPEDDMRYELKAEILLTSLLREKLYSKELEVEQLQAELAAAVRGNDILRCEVQNAMDN
LSCVTHKLKDLELQMLKKDENISQLQSDLQASTKELTVTRGILPKISEERDMMWEEVKKYNEKNMLLNSEINMLKKKIET
LDEDILLKEGQITILKDTIANKPFDLLSSPDSMRGFLLQ*

DNA
ATGAAGAAGCTCTTCTTTTTCAGATCTTCTGCTTCTAGCAATGGAAACAACAATGTTTCTCCATCAACTGATAAGCAGAT
ATACTGGGAGAACCCATCAGAAGATGGCAATCAAGTTGGTGACATGGCCGAGAATAGTTTCCGAAGCCCTAAGGGATTTT
TTTCTAAATCTCGAAAGCAAGTAACTGATATACAGAACTCTAGTAAAAGTCCAGGTCTTAGAAGGAGCCGGTCATTATCA
TCAGCAGCCTTTCTTGGAAATGAGCCAGCACAAAACAATTTTTCCTCTTCAAGATATCAAAGTAGATCTCCATGCAGTCC
TGCAAGTAGCGTTCCTCATCAACAATGTGGCCAATCATCTTGGACTCTTACTCCGGAGAGGTATGAGGCTAAACCTGTTG
AAGTTCCAGCTGTTCAAAATACACATGGACTAGAGAGGCCATGTTCTGCTGGCTCCTCTAGAATTCACCGTGATTCGTCT
GGGAGCTCCTCCACTTGCTCTAGTAATATCTCATCCAAAGTTTTGGACCGTTACATTGATGGAGAGCAGGAGGAAAGGGG
CAGACAGAAAAACAATTCTTCCTCTAGAAACTTATGTGGGAATGGAAATGGTGGTGGATTCCGTCCTCCGCGAGCTCAGT
TTACAGCACCCAATTCACCCAGGGCTCATTCATTTAGAGAGGCTAAAAGTTCTCGTTTTCGTTTGTCATCCAGAGACTGG
GCAGAAAATGGATTTGGGCATGAATCTCCCCGGAGACTTGCAAAGAATGTTGTTGAGAGGCTCTCACAGTCTCATGGTAT
TCAACCAACACATGAAAAGGAGTTTGACCATGATATGCCAGTCACCATCGAGGATATATATGGTAGATCAGATCTGGTTG
CCCAGAAAAATTATCATGGGGATGACTACTCAAGCTTGCAGAAACTTATCTATGGAGACAATTGTGACGGTTTAAACACC
GATGAGACTCAAGAAGACATGGATGTGGAATTGGAAAGAAGATTGAAGGAAGCTGAGGAGAATGTCATGCTTCTTTCAGA
AGAACTTGAACAGGAAAGCTTTCTTAGAGATAGTGGGTACAATGTTCAGCAAACAGTTAGAAACCTTACTGATCAGAGGA
TAGACTTGGCACTTGAGGTTTCAAACCTCCTACAGTTGCGCATTGCTGAGAGGGCTTCTGCCAAGAAAGAACTCAGACTG
GCAAAGGGAGAACTGGAGTCACGAACCAAAAAACTAGAGAAGGAGAAGAATGAGTTGCAGTCAGCATTGGAGAGGGAACT
AGACAGAAGGTCAACTGACTGGTCACTTAAGCTTGAGAAATATCAGTTGGAAGAGCAGAGGCTTCGTGAGCGGGTTAGAG
AGCTTGCAGAGCAAAATGTCTCACTTCAAAGAGAAGTTTCTTCCTTTAATGCGAGAGAAACTGAGAGTAGAAGTGTGATA
ACAAATTCAGAGCAACAGCTTAAGGGCCTCACAACAAGGCTGGGGGAAACGAGAGAGGAGAATCAAGATTTAAAAAATAA
TCTCTCAGACTTACAGGAGAAGTATAGAGCAGCGGAGGAAAATCGTGTTTGCATCCATAAAAGTTTTGAAGAGAAGGATA
AGGAGTGCAAGGATTTGCGGAAGTCTATTACAAGATTATTAAGAACCTGCAAAGAACAAGAGAAGACAATTGATGGCTTG
CGTGAAGGTTTTGGTGAGGAATTTAGGAAGAACCAATCATTGGAGAGGGTTGATAAGCATATTTCTAAATTGCAGATGGA
GCAGATAAGATTGACAGGAGTAGAGCTGGCCTTGAGAAGGGAGTTGGAATCTCATAGGCTTGAAGTTGATTCTCTTAGGC
ATGAGAATATACACTTGTTAGACCGGTTGAGAGGCAGTGGGAAAGAAAATGGTGCTTTGACCTTTAAGCTAGATAAGGAG
ATGTGGACACGGATCTGCTGTTTGCAAAATCAAGGGCTATCGATCCTAAACGAGAGCTCCCAGTTATGTTCAAATTTACT
GGAATTTGCCAAAGGGAAAGCAGGCCAACTTCCAGAATCTAAGAATGGTTTAGATGGGCAGTTTTTTGTTGAATCTGAAA
TGAAAGTTCAGGGCTTAAAGCGTGGAACTGAAAGTTTAGCAAGAAGTTTGCACACCATGTCTGCTTTGCTGCATGAAAAA
TCCAGTCTGGCCTCTTCAAAATATCCATCTAAGTGCATTAATGCTGATGGGTCTCCAAATGATCAAAATCCAGAGGACGA
TATGAGATATGAGCTTAAAGCAGAAATTTTACTAACAAGCCTACTAAGAGAAAAGTTGTATTCTAAAGAGCTGGAAGTTG
AGCAGTTGCAAGCCGAACTTGCAGCAGCTGTAAGAGGAAATGATATTCTCCGATGTGAAGTTCAAAATGCAATGGACAAC
CTTTCCTGTGTCACCCACAAGTTGAAGGACCTTGAACTGCAGATGCTTAAGAAGGATGAGAACATAAGCCAGCTTCAAAG
TGACCTCCAGGCATCTACGAAAGAATTAACAGTTACGAGGGGGATACTGCCAAAAATTTCAGAGGAGAGAGATATGATGT
GGGAGGAGGTGAAGAAATACAACGAGAAGAACATGTTACTGAACTCAGAGATTAATATGTTAAAGAAGAAGATTGAAACC
CTCGATGAAGACATACTTCTAAAGGAAGGTCAGATCACAATCCTCAAAGATACCATAGCGAACAAGCCGTTTGACCTTCT
ATCCAGTCCCGATTCTATGCGAGGTTTTTTGCTTCAATAA