Details for Peach Locus ppa000904m

Position : sca6 ( 5`- 25127156 .. 25123814 -3` )
Annotation : [B2G] predicted protein [Populus trichocarpa]
External links : CoGe
PGDD synteny : ppa000904m

Protein [Map View]
MAFKLFFFILLAPLLVRALEPVFNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLS
GHVGRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPQSL
SICQTLVAVNFSSNQLSGKLPSGIWYLRGLQALDLSDNLLEGEVPEGMENLYDLRVINFRKNWFSGKLPWDIGSCLLLKL
LDFSENFFSGSIPESIQRLSSCSSLSLQGNSFAGQIPNWLGDLRSLEMLDISGNNFSGGIPSSFGNLELLEKLNLSRNEF
TGSLPESLTNCIKLLAIDVSHNLLAGKLPSWIFKLGIQSVSLSGNRLSGSAEYSSLTSMEASNGGLQVLDLSSNEFSDVL
PSDIGVLSRLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNQLNGSIPSEIGGVVSLKELRLQKNFLTGKIPSQIEKCS
SLTSLMLSQNNLTGPIPAAIANLSNLQYVDLSLNKFSGSLPKELTNLSHLLYFNVSHNHLQGDLPLGGFFNTISPSSVSG
NPSLCGSVVNRSCTSVHPKPIVLNPNSSNPIGSSSSPTHGHKIIFSISALVAIGAAAFIAIGVIAVTVLNIHVRSSVSRS
AAPLELSGGEDYSCSPTTDPNYGKLVMFSGDADFGAGTQALLNKDCELGRGGFGVVYRTVLRDGRSVAIKKLTVSSLIKS
QEDFEREVKGLGKIRHHNLVALEGYYWTPSLQLLIYEYIPCGSLYKNLHDGLGKSCLTWRQRFNIILGMAKGLAHLHQIN
IIHYNLKSTNVLIDSSGAPKVGDFGLARLLPTLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGK
RPVEYMEDDVVVLCDMVRGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVPSNRPDMNEVINILELIQCPSEV
QEELE*

DNA
ATGGCATTCAAGCTCTTCTTTTTCATTCTTCTAGCTCCTCTCCTCGTACGTGCTTTAGAACCTGTTTTCAACGACGACGT
TCTGGGCCTGATCGTGTTCAAGGCCGGGCTTCGAGACCCAAAAGCCAAGCTCACTTCATGGAGCGAAGATGACAACAATC
CTTGCAGCTGGGTTGGTGTTAAATGCGACCCGAGAACCAACCGAGTCTCTGAGCTTGTTCTTGACGGCTTTTCTCTATCT
GGGCATGTAGGCCGAGGCCTTTTGAGGTTGCAATTCCTTCAAATACTCTCACTTGCGAATAACAACTTCACTGGGACCAT
AAACCCTGATCTCCCTCACCTTGGAAGCTTACAAGTCATTGATTTGAGCCAGAACAGCCTCTCTGGGCCGATCCCGGATG
AGTTTTTTATGCAATGTGGGTCGCTAAGAGTGGTTTCATTTGCTAGAAACAATCTCACAGGGCAGATTCCTCAGTCTTTG
AGCATATGCCAGACATTGGTGGCGGTGAACTTTTCCTCTAATCAGCTATCTGGGAAATTGCCATCTGGGATTTGGTATTT
GAGGGGCCTTCAAGCACTTGACTTGTCAGATAACTTGCTGGAGGGAGAAGTTCCTGAAGGTATGGAAAATTTGTATGATT
TGAGAGTAATTAACTTCCGAAAAAACTGGTTTTCGGGGAAGCTTCCCTGGGATATTGGAAGTTGTTTACTTTTGAAGTTG
CTTGATTTTAGTGAAAATTTCTTTTCTGGGAGCATTCCGGAGTCAATTCAGAGACTTAGTTCATGCAGTTCTCTGAGTTT
ACAGGGAAATTCTTTTGCTGGTCAAATTCCAAATTGGCTTGGTGATTTGAGGAGCCTTGAGATGTTAGATATCTCTGGTA
ATAATTTTTCTGGGGGAATTCCAAGCTCATTTGGAAATCTGGAGCTACTTGAAAAGTTAAATTTATCTAGGAATGAATTT
ACTGGAAGTTTGCCAGAGTCATTGACTAATTGCATCAAACTTTTAGCTATAGATGTTAGCCATAATCTGTTGGCAGGTAA
ACTTCCTTCATGGATTTTTAAGCTTGGTATACAAAGTGTTTCTCTTTCTGGCAACCGATTAAGTGGAAGTGCGGAATATA
GTTCATTGACATCAATGGAAGCCTCTAATGGGGGTCTTCAGGTCTTGGATTTGTCTTCCAATGAATTTTCTGATGTGCTT
CCATCCGACATTGGGGTTCTTAGTAGGTTGCAGTTCTTGAATATGTCTGGGAACCATCTCCTGGGTTCTATTCCAGCAAG
TATAGGTAAATTAAAGACAGCATCTGTTGTTGACTTGAGTGACAATCAACTAAATGGAAGCATTCCTTCTGAAATTGGAG
GGGTAGTCTCACTCAAGGAACTAAGGCTGCAGAAGAACTTTCTAACTGGGAAAATTCCATCTCAGATTGAGAAGTGTTCA
TCTCTAACATCTCTGATGCTGTCCCAGAACAACCTAACTGGGCCTATTCCTGCAGCCATTGCAAACCTTTCCAATCTTCA
ATATGTAGACTTGTCTTTAAACAAATTCTCTGGAAGCTTACCAAAAGAGCTGACAAATCTTTCCCACCTCCTCTACTTCA
ATGTCTCCCATAACCACCTTCAGGGTGACCTACCCTTAGGGGGCTTCTTCAACACTATCTCACCCTCATCTGTCTCGGGC
AATCCATCCCTATGTGGATCTGTTGTTAACCGTTCCTGCACTTCTGTCCACCCCAAACCCATTGTCCTCAACCCAAATTC
TTCCAACCCCATTGGCAGTTCTTCCTCACCAACTCATGGTCACAAGATCATATTCAGCATATCAGCTCTCGTTGCTATAG
GCGCAGCTGCATTCATTGCCATTGGTGTCATAGCTGTTACCGTCCTCAATATCCATGTGCGGTCTTCAGTTTCACGTTCT
GCGGCTCCTCTTGAGTTATCTGGTGGGGAAGATTATAGTTGTTCCCCTACTACTGATCCAAACTACGGCAAGCTTGTCAT
GTTTTCTGGTGATGCTGACTTCGGTGCCGGGACCCAAGCCTTGCTCAACAAGGACTGTGAACTTGGTCGTGGTGGGTTTG
GAGTAGTGTACAGAACAGTCCTTAGAGATGGGCGTTCAGTTGCAATAAAAAAGCTAACGGTCTCAAGTTTGATCAAGTCC
CAAGAAGATTTTGAGAGGGAAGTTAAGGGACTTGGAAAGATCAGGCACCATAATCTTGTGGCACTTGAAGGATATTACTG
GACTCCGTCGTTGCAGCTCCTCATATACGAGTATATACCTTGCGGGAGTCTGTATAAGAATCTGCATGATGGACTTGGAA
AAAGCTGCCTCACTTGGCGACAGAGGTTCAACATAATTCTAGGGATGGCAAAGGGTTTGGCTCATTTGCACCAAATAAAC
ATAATTCACTACAATTTGAAATCAACTAACGTTTTGATAGACAGCTCTGGTGCTCCAAAGGTAGGAGACTTTGGCCTGGC
AAGGCTGTTGCCAACGTTAGACCGGTGCATCTTAAGCAGCAAAATCCAAAGTGCACTTGGCTACATGGCGCCTGAGTTTG
CATGTCAAACGGTTAAGATTACTGAGAAATGTGATGTGTATGGGTTCGGAATCTTGGTTTTGGAGGTGGTGACAGGGAAG
CGGCCTGTGGAATATATGGAGGATGATGTGGTGGTACTTTGTGACATGGTGAGGGGAGCACTGGAGGAAGGCAGGGTAGA
GGAATGCCTTGACCAAAAGCTCCTGGGTAATTTTCCAGCAGATGAGGCAATTCCAGTGGTCAAGCTGGGTTTGATATGTG
CATCTCAAGTGCCATCAAACCGCCCGGACATGAATGAAGTAATCAACATTTTAGAACTCATCCAATGCCCTTCAGAAGTC
CAGGAGGAATTAGAATAA