Details for Peach Locus ppa000889m

Position : sca2 ( 5`- 23614838 .. 23611306 -3` )
Annotation : [B2G] atp binding
External links : CoGe
PGDD synteny : ppa000889m

Protein [Map View]
MKPLLVLFTVFVLAPVLGRSLNPSLNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFS
LSGHIGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRALDLSENSFSGPVPEDFFRQCGSLRTISLAKNKISGKIPE
SLGSCASLAAIDLSLNQFSGSVPVGIWSLNGIRSLDLSNNLLEGEISKAIGGLNNLRAVNLGKNRFTGQVPDGIGSCLLL
RSIDLSENSFSGNLPQTMQKFSLCSYLNLHQNSFAGEIPEWIGELKSLETLDLSGNRFLGEVPSSIGNLQALKVLNFSAN
GFTGSLPKSMAYCTSLVALDFSKNSMAGELPAWIFKAGLEEVSLSEKKLSGSANSPVSSSIGNAPQNLQVVDLSLNQFSG
EIASDIGVLSSLRSLNLSGNSLVGPIPVTIGELKALDNVDLSENRLSGSIPLEIGGAFSLKELRLENNLLTGKIPTSIGN
CSSLTTLIASQNRLNGPVPAAMAKLTNLQNVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPAGAFFNTISPSSV
SGNPSLCGSAVNKSCPTVLPKPIVLNPNSSSDSTTPGTLSSNLGHRRIILSISALIAIAAAAVIVIGVIAITVLNLRVRS
STTHSPAALALSAGDDFSHSPTTDGNSGKLVMFSGEPDFSTGAHALLNKDCELGRGGFGAVYRTVLRDGRPVAIKKLTVS
SLVKSQEEFEREVKKLGKVKHDNLVEIEGYYWTPSLQLIIYEYVSGGSLYKHLHDGAGGNFLSWNDRFNVILGTAKSLAH
LHQMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLE
VVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIR
CPSEGQEEL*

DNA
ATGAAACCGCTGCTCGTATTATTCACCGTCTTTGTTTTAGCTCCTGTTCTTGGGAGATCTCTGAACCCATCTCTGAACGA
CGACGTCTTGGGGCTGATAGTGTTCAAGGCTGATATTCAAGATCCAAAAGGAAAGTTAGCAACTTGGAGCGAAGACGACG
ATAGCCCATGTAAATGGGATGGCGTGAAATGCCATCCAAGATCCAACAGGGTCATTGAGCTCAGTCTTGACGACTTCTCT
CTTTCGGGTCATATAGGCCGAGGCCTCCTCCAGTTACAGTCTCTGCGAAAGCTGTCCCTCTCCAAGAACAATCTCACCGG
AAGCTTAACCCCTAATATTGCTCATATCGACAACCTACGAGCACTTGACTTGAGCGAGAACAGTTTCTCTGGTCCTGTAC
CCGAAGACTTCTTCCGGCAATGTGGGTCTTTGAGAACGATTTCTTTGGCCAAGAACAAAATTTCCGGGAAAATTCCTGAG
AGTTTGGGCTCTTGTGCGAGTCTTGCCGCAATTGACTTGTCGTTGAACCAGTTTTCGGGTTCGGTTCCAGTTGGGATTTG
GTCCTTGAATGGGATTAGATCACTGGATTTGTCTAATAATTTGTTGGAAGGTGAAATTTCAAAGGCCATTGGAGGACTGA
ATAACTTGCGAGCAGTTAATTTGGGGAAGAATCGGTTTACTGGGCAAGTTCCAGATGGAATTGGAAGTTGCTTGCTTTTG
AGGTCCATTGATCTCAGCGAGAATTCATTCTCTGGAAACCTTCCTCAGACAATGCAGAAATTTAGCCTGTGTAGCTATCT
AAATCTGCACCAGAACTCATTTGCCGGAGAGATTCCTGAGTGGATTGGAGAGTTGAAGAGCCTGGAGACTTTGGACCTTT
CTGGCAATCGATTTTTGGGCGAAGTTCCAAGTTCAATAGGTAATCTTCAGGCTTTAAAGGTGTTGAATTTTTCTGCAAAT
GGGTTCACTGGGAGCTTACCCAAGTCCATGGCTTATTGCACAAGCCTTGTGGCTTTAGATTTTAGTAAGAATTCGATGGC
GGGTGAACTTCCTGCGTGGATATTCAAGGCGGGTTTAGAGGAAGTTTCACTTTCAGAGAAAAAACTAAGTGGAAGCGCAA
ATAGCCCTGTATCTTCCTCAATTGGAAATGCGCCTCAAAATCTGCAAGTCGTGGATTTATCCCTTAATCAATTTTCTGGT
GAAATTGCATCTGACATTGGGGTCTTAAGCAGTTTACGTAGTTTGAACCTCTCCGGTAACTCTCTTGTTGGTCCTATTCC
TGTGACTATTGGAGAGTTGAAGGCCCTGGACAATGTGGATTTGAGTGAGAATCGGCTCAGTGGAAGCATCCCTCTGGAAA
TTGGTGGGGCTTTTTCGTTGAAGGAATTGAGATTGGAAAATAACCTTCTCACGGGAAAAATTCCAACTTCAATAGGGAAC
TGTTCTTCTCTGACCACTTTAATTGCATCACAGAACAGACTGAATGGCCCAGTACCTGCAGCAATGGCCAAACTTACCAA
CTTACAAAATGTGGACTTGTCTTTCAATAACCTCACGGGAGGCCTACCCAAGCAGTTAGCCAATCTTCCCAACCTTCTTT
CCTTCAATATTTCCCACAACAACCTCCAGGGTGAACTACCTGCGGGCGCCTTTTTCAATACCATCTCCCCTTCCTCTGTC
TCTGGCAATCCATCTCTTTGTGGCTCTGCAGTTAATAAGTCTTGCCCAACAGTTCTTCCGAAACCCATTGTCCTCAATCC
CAACTCCTCTTCTGACTCCACCACACCAGGAACATTATCTTCAAATCTTGGTCATAGAAGAATCATCCTTAGTATTTCTG
CACTCATTGCCATTGCTGCAGCTGCTGTCATTGTCATTGGTGTGATTGCCATCACTGTACTTAATCTCCGTGTTCGATCT
TCTACAACTCATTCACCAGCAGCCCTCGCGTTATCAGCTGGAGATGATTTCAGCCATTCCCCAACAACAGATGGCAACTC
CGGCAAGCTTGTCATGTTTTCAGGTGAGCCTGACTTCAGCACTGGTGCACATGCTCTACTCAACAAGGACTGTGAGCTTG
GTCGCGGAGGGTTTGGAGCAGTCTATAGGACAGTTCTTCGAGATGGGCGGCCTGTTGCAATCAAGAAGCTCACTGTTTCA
AGTCTTGTCAAGTCTCAAGAAGAATTTGAAAGGGAAGTTAAGAAATTGGGGAAAGTGAAGCACGATAATCTTGTGGAAAT
CGAAGGCTATTACTGGACTCCATCATTACAGCTCATCATATATGAATATGTCTCTGGCGGTAGTTTATATAAGCATCTTC
ATGATGGAGCAGGTGGAAACTTCCTGTCATGGAACGACAGGTTCAATGTAATTCTTGGAACTGCGAAAAGTTTGGCTCAT
TTGCATCAAATGAACATAATTCACTACAACATAAAATCTAGCAATGTCCTGATCGGCAGCTCAGGCGAACCCAAAGTGGG
AGACTTTGGCCTAGCAAGGTTGTTGCCAATGCTTGACCGATATGTTTTGAGCAGCAAGATCCAGAGTGCCCTTGGCTACA
TGGCACCAGAGTTCGCTTGCAAAACAGTAAAGATAACTGAGAAATGTGACGTGTATGGGTTTGGGGTTTTGGTTCTGGAG
GTGGTCACTGGGAAGAGGCCTGTCGAGTACATGGAAGATGATGTTGTGGTTCTTTGTGACATGGTCAGAGGAGCATTAGA
AGAAGGCAGAGTAGAGGAGTGCATTGATGGCAGGCTCCAAGGAAATTTCCCTGCAGAAGAGGCTATTCCTGTTATGAAAT
TAGGCTTGATATGCACGTCACAAGTGCCGTCAAACAGACCAGACATGGCGGAGGTGGTCAACATATTGGAGCTGATCAGA
TGTCCATCGGAAGGCCAAGAGGAGTTGTGA