Details for Peach Locus ppa000482m

Position : sca2 ( 5`- 22237177 .. 22231930 -3` )
Annotation : [B2G] ap3-complex subunit beta-a-like
External links : CoGe
PGDD synteny : ppa000482m

Protein [Map View]
MFPQFGATADTLSKASTMVFRIGTDAHLYDDPDDVSIAPLLDSKFDSEKCEALKRLLALIAQGFEVSNFFPQVVKNVASQ
SLEVKKLVYLYLLHYAQKRPNEALLSINYFQKDLGDPNPLVRAWALRTMAGIRLHVIAPLVLVAAGKCARDPSVYVRKCA
ANALPKLHDLRLDENTAGIEEIIGILLNDHSPCVVGAAAAAFSSVCPNNLALIGRNYKRLCEILPDVEEWGKIILIGILL
RYIIARHGLVKESIMFSLHSTENSQSEKDCSDTNSALVEDNGDMSGRYQSELANIVSRCYIEGPAEHLSRLSLMNKDASE
CNYASFTSGKNNDDVKILLQCTSPLLWSNNSAVVLAAAGVHWIMAPIEDLKRIVKPLLFVLRSSNASKYVVLCNVQVFAK
AIPSLFSLYFEDFFICSSDSYQIKALKLDILAYIATDSSISFILKEFQDYIRDPDRRFAADTVAGIGICAQRLPEMANTC
LEFLLALTRQQLMTGEFGSVDGEADILIQAIMSIKSIIQQDPPSHEKVIIQLVRSLNSIKVPAARAIIVWMVGEYNSLGD
LIPKMLATVLKYLAWCFTSEELETKLQICNTTVKVLLHAKGNDLLTIKKVLIYVLELAKCDLNYDIRDRAHFLRKILSTY
LDSRGLEEETNCLAQHKDSSCVLAEYLFGGQKKPMPHEPIDHRFYLPGSLSQIVLHAAPGYEPLPKPCSLRCDGLKMNEF
GEGVTNGDPYVTDNEDSESEFLDEENASSYSSQHSDMDSSGSGGSEEAGSASEGDENSHPLIQFSDVGNANEKKNIASQS
ASDFGELLSNRALESWLDEQPGFSSTNTSEQSQVRRSSARISIGDIGGQIKPKSYALLDPVNGNGLKADYSFSSEISSIS
PLFLCIEVSFKNCSKEIVSDITLVDEESGKGMDSVDQASGSRESSTTPENNEPNLVSVEEIASLEPGQAMTRTVQVRFHH
HLLPLKLTLYCNGKRHPVKLRPDIGYFVKALPMDVEAFTKKESHLRGMFECVRRCTFTDHIKELDKDKGDDSLVEDKFLV
ICRNLALKMLSSANLHLVSVDLPVAANLDDATGLCLRFSSKLLSTSAPCLITITVQGRCSEPLEMSVKVNCEETVFGLNL
LNRIVNVLVEPSHAHE*

DNA
ATGTTCCCTCAATTCGGCGCAACAGCAGATACTCTAAGCAAGGCGTCGACAATGGTGTTCCGGATCGGTACGGACGCCCA
CCTCTACGACGATCCCGATGATGTCAGCATCGCTCCTCTTCTTGACAGCAAGTTCGACTCTGAAAAATGCGAAGCTCTCA
AGCGCCTGCTCGCTCTCATCGCCCAGGGCTTCGAAGTCTCCAATTTCTTCCCTCAGGTTGTTAAGAACGTAGCATCGCAG
TCATTGGAAGTGAAAAAGCTGGTTTACTTATACCTGCTGCATTATGCTCAAAAGCGTCCGAATGAAGCATTGCTATCGAT
TAATTACTTCCAGAAGGATTTGGGGGATCCAAATCCGTTAGTGAGGGCATGGGCCCTGAGAACCATGGCGGGGATCCGTC
TACATGTTATTGCACCGTTAGTTCTTGTTGCCGCTGGAAAATGTGCTAGAGATCCCTCTGTGTATGTTAGAAAATGCGCG
GCCAATGCTCTTCCTAAGCTGCACGATTTGCGCCTTGACGAAAATACCGCGGGGATTGAAGAGATTATCGGAATATTGTT
GAATGACCACTCCCCTTGTGTCGTTGGTGCTGCTGCCGCTGCTTTCTCTTCCGTTTGTCCGAATAATTTGGCTCTGATTG
GAAGAAATTATAAAAGGTTATGCGAGATTCTTCCTGATGTGGAAGAATGGGGTAAAATAATTTTAATCGGGATCCTTTTG
CGCTATATAATTGCGAGGCATGGGCTTGTAAAGGAATCCATTATGTTTTCTTTGCACAGTACAGAGAATTCTCAATCTGA
AAAGGATTGTTCAGACACCAACTCTGCGTTAGTGGAAGACAACGGTGACATGAGTGGTCGTTATCAGTCTGAATTAGCAA
ATATTGTATCCCGTTGTTATATTGAAGGACCAGCTGAACATTTATCACGATTAAGTCTCATGAATAAAGATGCATCTGAA
TGTAATTATGCCAGTTTTACATCTGGAAAGAACAATGATGATGTGAAGATCCTGCTGCAGTGTACATCCCCATTGTTATG
GAGTAATAATAGTGCAGTTGTACTAGCAGCTGCTGGTGTACACTGGATTATGGCACCCATAGAGGATTTGAAAAGAATTG
TTAAGCCGCTGTTGTTCGTTCTAAGATCATCTAATGCCTCAAAATATGTGGTTTTATGTAACGTTCAAGTGTTTGCAAAA
GCAATTCCTTCACTCTTCTCTCTGTACTTTGAAGACTTCTTTATATGCTCTTCAGATTCATATCAAATTAAAGCTTTGAA
ACTGGATATACTGGCTTACATTGCCACAGATTCATCAATTTCATTTATACTCAAAGAATTTCAGGATTATATTAGAGATC
CAGACAGGAGATTTGCTGCTGATACTGTTGCTGGAATTGGCATATGCGCGCAGCGACTTCCAGAAATGGCAAACACATGC
TTAGAATTTTTATTGGCTTTGACCAGACAGCAACTTATGACTGGTGAGTTCGGGTCTGTGGATGGTGAAGCAGATATTTT
GATTCAAGCAATAATGTCTATTAAATCAATCATTCAGCAAGATCCACCCAGTCATGAAAAGGTTATTATTCAGTTGGTTC
GTAGTTTAAATTCAATAAAGGTGCCTGCTGCACGGGCTATAATTGTTTGGATGGTGGGGGAGTATAACTCTTTAGGTGAT
CTCATCCCAAAGATGTTAGCTACAGTACTCAAGTATCTTGCATGGTGCTTTACTTCAGAAGAGTTGGAAACAAAGCTTCA
AATTTGTAATACTACTGTTAAGGTTTTATTGCATGCAAAAGGGAATGATCTGTTGACTATCAAAAAAGTTTTAATCTATG
TGCTGGAACTGGCCAAATGCGACTTAAACTATGACATTCGTGATCGAGCTCATTTCTTAAGGAAAATTCTGTCAACTTAT
TTAGATTCTCGAGGTCTGGAGGAGGAAACCAATTGTCTGGCCCAGCATAAAGATAGTTCATGTGTCCTTGCGGAATACTT
ATTTGGAGGACAAAAAAAACCAATGCCACATGAGCCCATTGATCACCGGTTTTACCTTCCTGGCTCTTTATCACAGATAG
TACTTCATGCTGCTCCAGGGTATGAACCTCTCCCAAAGCCCTGTAGTTTGCGCTGTGATGGCCTCAAAATGAATGAATTT
GGAGAGGGAGTCACTAATGGTGATCCATATGTTACAGACAACGAGGACTCAGAGTCTGAATTTTTGGATGAGGAAAACGC
TTCTAGTTATAGTTCACAACACTCTGATATGGATTCAAGTGGCAGTGGTGGCAGTGAAGAGGCAGGTTCTGCAAGTGAAG
GCGATGAAAATTCTCATCCCTTGATTCAATTTTCAGATGTTGGAAATGCTAATGAAAAGAAAAATATAGCTTCTCAGTCT
GCTTCTGATTTTGGGGAATTGTTGTCAAATAGAGCTTTAGAATCATGGTTAGATGAGCAGCCTGGTTTTTCAAGCACAAA
TACTTCAGAACAAAGTCAAGTCCGTAGATCTTCAGCAAGAATCTCCATTGGTGATATTGGAGGTCAAATTAAACCTAAAA
GCTATGCACTCTTGGATCCTGTGAATGGAAACGGCTTAAAGGCTGACTATTCATTTTCATCTGAGATTTCAAGCATCTCT
CCTTTGTTTCTATGTATAGAAGTTTCCTTCAAGAACTGTTCAAAGGAAATCGTGTCTGATATAACTTTGGTTGATGAGGA
ATCCGGCAAAGGCATGGATTCTGTAGACCAAGCTTCGGGTTCACGTGAAAGCTCAACAACACCTGAAAATAATGAGCCAA
ATCTAGTTTCTGTAGAAGAGATCGCTTCTCTAGAACCTGGTCAGGCAATGACAAGAACCGTCCAGGTTCGCTTCCATCAC
CACCTTTTGCCTCTAAAACTGACCTTATATTGTAATGGCAAGAGGCATCCTGTTAAGTTGCGGCCCGACATTGGATACTT
TGTAAAAGCTCTTCCTATGGATGTTGAAGCCTTCACAAAAAAGGAGTCTCATCTGCGAGGAATGTTTGAATGTGTAAGAA
GGTGCACCTTCACTGATCATATCAAGGAGTTGGACAAGGACAAGGGTGACGATTCATTGGTAGAAGACAAATTTCTCGTA
ATCTGCCGAAATCTTGCATTGAAAATGCTTAGCAGTGCAAATCTTCATCTTGTATCTGTTGATTTGCCAGTCGCAGCGAA
CCTCGATGATGCAACAGGTTTGTGCTTACGATTCAGCAGCAAGCTTTTGAGCACCTCTGCCCCCTGCTTGATCACCATCA
CCGTTCAAGGTAGATGTTCTGAACCGTTGGAAATGTCAGTTAAAGTAAACTGCGAAGAAACTGTATTCGGGCTGAATCTG
CTGAACAGGATCGTGAATGTATTGGTTGAGCCCTCTCATGCCCATGAGTAG