Details for Peach Locus ppa000434m

Position : sca5 ( 5`- 18088232 .. 18094031 -3` )
Annotation : [B2G] atp-binding protein
External links : CoGe
PGDD synteny : ppa000434m

Protein [Map View]
MGDSNSVDVILDFLRKNRFSRAEAALRSELSNRPDLNGFLQKLTLEEKDLGNSLEAENGDKLVVENQGLGSRNGGEVSKE
LIVKEIEYGTGRNGSEIKWKNTASIGERNKTIDVAGTNHKSFAFSKGLEDTVLDLYSWKVNPSNGPAEPCQNDGDGSINN
YPQPQISHQSRNHTAEVPDSGKAIVKYGEEILFSGEKKTSWAGSTSKANVELKYDRTQTSEPKELDQQLKTSTSFFKENV
ADNPWSRIEEPSNSPSEMWKDCSVKTVFPFSKGDVPTSYDSASASDKKEGKRKAELADIRATIKDQVDEVGRALYLSKSQ
GSSEQNTISSLVFPILSENQKEEFPRLPPVKLKSEDKPLNINWEEKFERDVPGSKLSAADNALLIGSYLDVPIGQEINSS
GGKRNVGGGSWLSVSQGIAEDTSDLVSGFATVGDGLSESVDYPNEYWDSDEYDDDDDVGYMRQPIEDEAWFLAHEIDYPS
DNEKGTGHGSVPDPQERGPTKDEDDDQSFAEEDSYFSGERYFQAKNVEPIVTSDDPIGLTVTELYGRSDENDLIAQYDGQ
LMDEEELNLMRAEPVWQGFVTQTNELIMLGDGKVLNECGRPRLDDVCVDDDQLGSVRSIGVGINSDAADIGSEVRESLVG
GSSEGDLEYFRDHDVGIGGPRKHHHESDKKNIDRSNKDKKKTSKHEANKYIVETDTGVVRQKKNHTEGVFSFPPPLRDGQ
LVQASSSKSLWSNNCNAVVADETDDCMVGSDNMLTSWRQKSNDSSPRMSSRDENNANAVRSTNSTPSTLSNYAYAEREHA
KQEEEDKIAAVREEDTGASLEDEEAAAVQEQVRQIKAQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLNSVIAGRYHVTE
YLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNKHDPGDKYHILRLYDYFYYREHLLIVCELLKA
NLYEFHKFNRESGGEVYFTMPRLQSITIQCLEALKFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCSY
VQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSPATLLARVMGIICPIDQSMLAKGRDTYKYFTKNHML
YERNQETNRLEYLIPKKTSLRHRLPMGDQGFIDFVAHLLEINPKKRPSASEALKHPWLSYPYEPISS*

DNA
ATGGGGGACTCAAACTCCGTTGACGTGATTCTGGACTTTCTGCGGAAGAATAGGTTTTCAAGAGCTGAGGCAGCTCTTCG
CAGTGAGCTCAGTAATCGTCCTGATTTGAATGGTTTCCTTCAGAAGCTTACTCTTGAAGAGAAGGACTTGGGTAATTCGT
TGGAAGCTGAAAATGGGGACAAATTGGTGGTGGAAAATCAAGGGTTGGGGTCTAGGAATGGTGGTGAAGTTTCTAAGGAA
CTTATAGTGAAAGAGATAGAGTATGGAACTGGTAGAAATGGGTCTGAAATCAAATGGAAAAATACTGCTTCTATTGGGGA
GCGGAATAAAACTATTGATGTGGCTGGGACAAATCACAAGAGCTTCGCATTCTCTAAAGGTTTAGAGGACACAGTGCTTG
ATTTATATTCATGGAAGGTCAATCCTAGCAATGGACCTGCAGAACCTTGTCAAAATGATGGAGATGGTAGTATCAATAAC
TACCCACAGCCTCAGATATCCCACCAATCAAGGAATCATACAGCTGAGGTTCCTGATTCGGGTAAAGCCATTGTGAAATA
TGGAGAAGAGATTCTCTTCTCTGGTGAAAAGAAAACTTCTTGGGCTGGAAGTACTAGCAAAGCTAATGTGGAATTGAAGT
ACGACAGAACCCAAACAAGTGAACCTAAGGAACTTGACCAACAACTTAAGACAAGTACCTCATTCTTCAAAGAAAACGTA
GCAGATAATCCATGGTCAAGAATTGAAGAACCTTCAAATTCACCTTCAGAGATGTGGAAAGATTGTTCTGTCAAGACGGT
ATTTCCATTCTCCAAGGGGGACGTGCCAACAAGTTATGATAGTGCTTCCGCTTCTGACAAAAAAGAAGGAAAGAGAAAAG
CTGAGTTGGCTGATATTAGGGCAACAATAAAGGATCAGGTTGATGAGGTGGGAAGAGCTTTATACTTAAGCAAGTCACAA
GGCAGTTCCGAGCAAAATACCATCAGTAGCTTAGTTTTTCCTATTCTTTCTGAGAATCAAAAGGAAGAGTTCCCTAGGCT
ACCGCCTGTCAAACTCAAGTCAGAGGACAAACCATTGAATATTAATTGGGAGGAAAAGTTTGAGCGAGATGTACCTGGCT
CAAAACTCAGCGCTGCTGACAATGCTCTTCTTATTGGGTCATATTTGGATGTCCCTATTGGACAAGAAATCAATTCTTCA
GGTGGAAAAAGGAATGTAGGAGGAGGCAGTTGGCTGTCTGTAAGTCAGGGGATTGCAGAGGATACATCTGATCTAGTTTC
TGGTTTTGCTACTGTTGGTGATGGATTGAGTGAATCTGTTGACTATCCAAACGAGTATTGGGACTCTGATGAATATGATG
ATGATGATGATGTGGGATACATGAGACAGCCTATTGAAGATGAGGCCTGGTTTCTGGCCCATGAAATCGATTACCCAAGT
GACAATGAAAAGGGAACAGGGCATGGGAGTGTTCCGGATCCACAGGAAAGAGGTCCCACCAAAGATGAGGATGATGACCA
ATCTTTTGCTGAGGAGGATTCTTACTTTTCTGGTGAGCGGTACTTTCAAGCGAAAAATGTTGAACCAATTGTAACTTCAG
ATGATCCTATAGGACTAACAGTGACTGAATTGTATGGGAGGAGTGATGAGAATGATTTAATAGCTCAATATGATGGACAG
TTGATGGATGAAGAGGAACTTAATTTGATGCGTGCAGAACCTGTCTGGCAGGGCTTCGTCACTCAGACTAATGAACTCAT
CATGTTAGGGGATGGGAAAGTTCTGAATGAGTGTGGAAGGCCACGTCTAGATGATGTTTGTGTGGATGATGATCAGCTTG
GTTCAGTAAGATCAATAGGTGTGGGAATCAATAGTGATGCTGCTGATATTGGCAGTGAAGTACGGGAAAGTTTGGTTGGA
GGCAGTAGTGAAGGGGATCTAGAATACTTTCGAGACCATGATGTAGGAATTGGTGGGCCCCGGAAGCATCATCATGAATC
AGATAAGAAAAACATTGATAGATCTAACAAGGACAAAAAGAAAACTAGTAAACATGAGGCAAATAAATATATAGTTGAGA
CTGATACGGGTGTAGTAAGACAGAAGAAAAATCATACAGAAGGGGTATTTTCATTCCCTCCACCACTTAGAGATGGACAG
TTGGTGCAGGCAAGCTCTAGTAAATCTTTATGGTCAAACAACTGCAATGCTGTTGTCGCTGATGAAACTGATGACTGTAT
GGTGGGTTCTGACAACATGCTCACTTCATGGAGGCAGAAAAGTAATGATTCCTCACCTAGAATGAGTTCTAGGGACGAAA
ATAATGCTAATGCTGTTAGATCCACAAACTCTACTCCCTCAACACTCTCTAATTATGCTTATGCCGAGAGAGAGCATGCC
AAGCAAGAAGAAGAAGATAAAATTGCTGCTGTTAGGGAAGAAGATACAGGAGCATCACTTGAGGATGAAGAGGCAGCTGC
TGTGCAAGAGCAAGTAAGGCAAATAAAGGCTCAAGAGGAAGAGTTTGAGACCTTCAACCTCAAGATTGTGCATAGAAAAA
ACAGAACTGGCTTTGAAGAGGACAAAAATTTTCATGTTGTGTTGAATTCTGTGATAGCCGGGCGCTATCATGTCACCGAA
TATCTTGGATCAGCTGCTTTCAGCAAAGCAATACAAGCTCATGATCTGCATACAGGCATGGATGTTTGTGTGAAAATTAT
AAAGAACAACAAAGATTTCTTTGATCAGAGTCTTGATGAGATAAAGCTTCTCAAATACGTCAATAAGCATGATCCTGGTG
ACAAGTACCACATTCTACGTTTGTACGATTACTTCTATTATCGAGAACATCTGTTGATAGTATGTGAACTTCTCAAAGCA
AACTTGTATGAATTTCATAAGTTTAATCGGGAGTCAGGAGGGGAGGTCTACTTCACAATGCCAAGACTGCAGTCGATTAC
GATTCAGTGTCTAGAGGCGCTTAAGTTTTTGCATGGCCTTGGCCTGATACATTGTGACTTGAAGCCTGAGAATATACTGG
TGAAAAGCTACAGTAGGTGTGAGGTGAAAGTCATTGATCTTGGGAGTAGTTGCTTTGAGACAGATCATCTCTGCTCCTAT
GTTCAGTCTAGATCATATCGTGCTCCTGAGGTTATCTTGGGACTTCCATATGATAAGAAGATAGATATATGGTCACTTGG
CTGCATCTTGGCCGAACTTTGTACTGGCAATGTGCTCTTCCAGAATGATTCACCTGCAACTTTACTTGCACGGGTGATGG
GAATCATTTGCCCCATTGATCAAAGTATGCTAGCCAAAGGACGTGATACATATAAATACTTCACAAAAAATCACATGCTT
TATGAACGGAATCAGGAAACTAACAGACTGGAATATCTGATACCGAAAAAGACATCCTTGAGGCACCGGCTGCCAATGGG
AGACCAAGGCTTCATTGACTTTGTTGCTCATCTGCTTGAGATAAACCCGAAGAAGCGGCCTTCTGCATCTGAAGCTCTGA
AGCACCCGTGGCTATCATATCCTTATGAACCCATATCATCTTGA