Details for Peach Locus ppa000395m

Position : sca2 ( 5`- 21719788 .. 21715430 -3` )
Annotation : [B2G] splicing factor 3b subunit 3-like
External links : CoGe
PGDD synteny : ppa000395m

Protein [Map View]
MYLYSLTLQRATGIVCAINGNFSGGKAQEIVVARGKVLELIRPDENGKIQTLLSVEIFGVIRSLAQFRLTGSQKDYIVVG
SDSGRIVILEYNKEKNVFDKVHQETFGKSGCRRIVPGQYLAIDPKGRAVMVGACEKQKLVYVLNRDTSARLTISSPLEAH
KSHTIVYSICGVDCGFDNPIFAAIELDYSEADQDSTGQAANEAQKHLTFYELDLGLNHVSRKWSDQVDNGANLLVTVPGG
GDGPSGVLVCAENFVIYKNQDKPDLRAVIPRRADLPAERGVLIVSAAMHKQKSMFFFLLQTEYGDIFKVTLDHDNDKVSE
LKIKYFDTIPVTTSMCVLKSGFLFAASEFGNHSLYQFRAIGEDPDVESSSATLMETEEGFQPLFFQPRRLKNLVRIDQVE
SLMPIMDMKVNNLFEEETPQIFTLCGRGPRSSLRILRPGLAISEMAVSELPGVPSAVWTVKKNVSDEFDAYIVVSFANAT
LVLSIGETVEEVSDSGFLDTTPSLAVSLIGDDSLMQVHPNGIRHIREDGRINEWRTPGKRTIVKVGSNRLQVVIALSGGE
LIYFEVDMTGQLMEVEKHEMSGDVACLDIAPVPEGRQRSRFLAVGSYDNTIRILSLDPDDCMQILSVQSVSSIPESLLFL
EVQASIGGEDGADHPASLFLNAGLRTGILFRTVVDMVTGQLSDSRSRFLGLRAPKLFSVSVRGKHAMLCLSSRPWLGYIH
QGHFLLTPLSYETLEYAASFSSDQCAEGVVAVAGNALRVFTIERLGETFNETVVPLRYTPRKFVVQLKRKLLVIIESDQG
AFTAEEREAAKKECFEAAGIGENGNGNVDQMENGGDNEDDPLSDEHYGYPKAESEKWVSCIRVLDPKTATTTCLLELQDN
EAAFSICTVNFHDKEYGTLLAVGTAKGLQFWPKRSVTAGYIHIYRFLDDGKSLELLHKTQVDGVPLALCQFQGRLLAGVG
PVLRLYDLGKKRLLRKCENKLFPNSIISIQTYRDRIYVGDIQESFHYCKYRRDENQLYIFADDCVPRWLTASYHIDFDTM
AGADKFGNVYFVRLPQDVSDEIEEDPTGGRIKWEQGKLNGAPNKVEEIVQFHVGDVVSCVQKASLIPGGGECIIYGTVMG
SLGALLAFTSRDDVDFFSHLEMYMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLPMDLQRKIADELDRTPGEI
LKKLEEIRNKII*

DNA
ATGTATCTTTACAGCCTCACTCTTCAGCGAGCGACGGGCATAGTCTGTGCCATCAATGGCAATTTCTCCGGCGGAAAGGC
CCAAGAGATTGTCGTCGCCAGAGGCAAAGTTCTCGAACTTATTCGACCCGACGAAAATGGTAAGATCCAGACTCTACTCT
CTGTTGAAATTTTTGGCGTCATTAGGTCTTTAGCTCAGTTTAGGCTCACTGGTTCTCAGAAAGACTATATTGTTGTTGGG
TCCGATTCGGGTCGAATAGTAATTCTTGAGTATAACAAGGAAAAGAATGTCTTTGATAAAGTCCATCAAGAAACTTTCGG
TAAGTCGGGTTGTCGCCGGATAGTTCCGGGCCAGTATTTGGCCATTGACCCCAAGGGGAGGGCTGTTATGGTTGGGGCCT
GTGAAAAGCAGAAGCTTGTTTACGTTTTGAATAGGGATACATCTGCAAGGTTAACTATATCATCCCCCTTGGAGGCCCAC
AAGTCGCATACGATAGTGTATTCGATTTGTGGGGTTGATTGTGGGTTTGATAACCCCATATTTGCTGCCATTGAGTTGGA
TTATTCGGAAGCTGATCAGGACTCTACTGGGCAGGCGGCAAACGAGGCACAGAAGCATTTGACTTTCTACGAGCTCGACC
TTGGGCTTAACCATGTCTCTAGGAAGTGGTCGGATCAGGTTGATAATGGTGCAAATTTACTGGTCACAGTTCCTGGAGGT
GGGGATGGGCCAAGTGGCGTATTGGTCTGTGCGGAAAATTTTGTGATTTACAAGAATCAGGATAAACCGGATCTTAGGGC
CGTGATTCCCAGGCGTGCAGATTTGCCAGCTGAGCGTGGGGTTCTTATAGTTTCAGCAGCTATGCACAAGCAGAAGTCAA
TGTTCTTTTTCCTTTTGCAGACAGAGTATGGGGATATATTTAAGGTTACTCTGGACCATGATAATGACAAGGTCTCAGAA
TTGAAGATCAAATATTTTGATACAATTCCAGTTACAACTTCAATGTGTGTGTTAAAATCTGGGTTTTTGTTTGCTGCGTC
AGAGTTTGGGAATCACTCTTTGTACCAGTTCCGAGCAATAGGCGAAGATCCTGATGTGGAGTCTTCCTCAGCTACATTGA
TGGAAACTGAAGAAGGTTTCCAACCTTTGTTTTTCCAGCCTAGAAGACTTAAGAACCTTGTTAGGATTGATCAGGTTGAG
AGCTTAATGCCGATAATGGATATGAAGGTCAATAATCTCTTTGAGGAAGAAACACCTCAAATATTTACACTTTGTGGGCG
GGGCCCTCGTTCATCCCTCAGGATTCTAAGGCCCGGTTTAGCTATCAGTGAGATGGCTGTGTCAGAGCTTCCAGGTGTAC
CGAGTGCAGTCTGGACAGTGAAAAAGAATGTATCTGATGAGTTTGACGCATACATTGTGGTGTCATTTGCAAATGCTACC
CTTGTGCTTTCAATTGGTGAGACAGTGGAAGAAGTTAGCGACAGTGGGTTTCTTGACACTACCCCATCACTTGCAGTTTC
TTTGATAGGTGATGATTCTCTCATGCAAGTTCACCCAAATGGAATTAGGCATATTAGGGAAGATGGACGTATTAATGAAT
GGAGAACTCCTGGAAAGAGAACGATCGTCAAGGTTGGCTCTAATAGACTTCAAGTGGTTATTGCTTTGAGCGGCGGAGAA
CTTATATATTTTGAAGTTGATATGACGGGTCAATTGATGGAGGTGGAGAAGCATGAAATGTCTGGTGATGTAGCTTGTCT
GGACATTGCCCCTGTACCTGAAGGGAGACAGAGATCTCGTTTCCTTGCAGTTGGTTCATATGACAACACTATTCGTATTT
TGTCATTGGATCCTGATGACTGTATGCAGATTCTGAGTGTGCAAAGTGTTTCTTCAATTCCAGAATCTCTCCTATTTCTT
GAGGTTCAGGCATCAATTGGTGGGGAGGATGGTGCTGATCATCCTGCCAGCCTTTTCCTTAATGCTGGTTTACGTACTGG
GATTCTGTTCAGGACAGTGGTAGATATGGTGACAGGTCAGCTTTCTGATTCCCGTTCACGATTCTTAGGACTAAGAGCTC
CGAAGCTATTTTCTGTTAGTGTGAGAGGCAAGCATGCTATGCTTTGTTTGTCAAGTCGGCCCTGGCTAGGTTATATTCAT
CAAGGACATTTTCTGTTAACACCCCTATCTTATGAGACACTTGAATATGCCGCATCATTTTCATCTGATCAATGTGCGGA
AGGTGTAGTTGCTGTTGCTGGAAATGCTTTGAGGGTTTTTACTATTGAAAGGTTAGGAGAAACCTTTAACGAAACTGTGG
TTCCACTGAGGTACACTCCCAGAAAGTTTGTTGTTCAACTCAAACGAAAGCTATTAGTAATTATTGAAAGTGATCAAGGA
GCATTCACAGCAGAAGAGCGTGAAGCTGCAAAAAAGGAGTGCTTTGAGGCTGCAGGAATTGGTGAAAATGGAAATGGTAA
TGTGGATCAGATGGAAAATGGTGGTGATAATGAGGATGATCCCCTCTCCGATGAGCACTATGGCTATCCTAAGGCAGAGT
CTGAGAAATGGGTTTCTTGCATTAGAGTTCTTGACCCCAAGACAGCAACTACAACTTGTCTGCTGGAGCTTCAGGATAAT
GAAGCTGCATTCAGTATATGCACAGTGAATTTCCACGATAAGGAGTATGGTACGCTTTTAGCTGTTGGTACAGCAAAGGG
ACTGCAGTTTTGGCCCAAAAGAAGTGTAACGGCAGGGTATATTCATATCTATAGATTTCTAGATGATGGAAAGTCCCTTG
AACTTTTGCACAAGACACAAGTGGATGGTGTTCCTCTTGCTTTATGCCAGTTTCAGGGAAGATTACTAGCAGGCGTAGGA
CCAGTGCTCAGACTGTATGATTTGGGGAAAAAAAGATTGCTTAGAAAATGTGAGAATAAGCTGTTTCCCAACTCCATTAT
ATCTATTCAAACCTATCGTGATAGGATTTACGTAGGTGACATTCAAGAGTCATTTCACTACTGCAAGTACAGACGAGATG
AGAATCAGTTGTATATCTTTGCTGATGATTGTGTTCCAAGATGGCTTACAGCGTCATACCATATAGATTTTGACACCATG
GCAGGTGCAGACAAGTTTGGAAATGTCTATTTTGTGCGGTTACCACAGGATGTTTCAGATGAGATAGAAGAGGATCCAAC
AGGTGGGAGGATAAAATGGGAGCAGGGGAAGTTGAACGGCGCTCCCAACAAAGTAGAGGAGATAGTGCAGTTTCATGTTG
GTGATGTGGTCAGCTGTGTGCAGAAGGCATCTCTAATTCCAGGTGGTGGGGAATGCATCATCTATGGGACAGTGATGGGT
AGCTTGGGTGCATTGCTTGCATTCACCTCTCGTGATGATGTTGACTTCTTTTCTCACCTGGAGATGTATATGAGGCAGGA
GCATCCGCCCTTGTGTGGTAGAGATCACATGGCTTATAGATCAGCTTATTTTCCAGTTAAGGATGTGATTGATGGAGATC
TGTGCGAGCAGTTCCCAACATTGCCTATGGATCTGCAGAGAAAAATTGCGGATGAGTTGGATAGAACTCCTGGAGAGATA
CTGAAGAAACTTGAGGAAATTCGAAATAAGATCATTTAA