Details for Peach Locus ppa000245m

Position : sca2 ( 5`- 21862980 .. 21870274 -3` )
Annotation :
External links : CoGe
PGDD synteny : ppa000245m

Protein [Map View]
MMISRGLFGWSPPHIQPLTPVSEVSEPPESPSPYMDQSADASAQPMEQEEEMEEPEEIEPPPAAVPFSRLFTCADRLDWV
LMTVGSLAAAAHGTALVVYLHYFAKIIQILWMGKNHPGDQPPPTDISEEQFQKFMDLALSIIYIATGVFAAGWIEVSCWI
LTGERQTAVIRSNYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLIIGFINCWQIAA
ITLATGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQG
LGLGFTYGLAICSCALQLWVGRFLVSQGKAHGGEIITALFAVILSGLGLNQAATNFYSFDQGRIAAFRLFEMISRSSSTV
NHEGTTLVTVQGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENI
KNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATVDQIEEAAKIAHAHTFITSLEGSYDTQVGRAGLALTEEQKIKL
SIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMEEGQLVEMGTHDELLTLD
GLYAELLKCEEAAKLPRRMPLRNYKETATFQIEKDSSASHSFQEPSSPKMMKSPSLQRASGMFRMGDGNFNSEESPNARS
PPAEKMLENGQPLDSADKEPSIKRQDSFEMRLPELPKIDVQSVNQQTLNGSDPESPVSPLLTSDPKNERSHSQTFSRPHS
HSDDFPMKLKEEKSTHQKKAPSFWRLAQLSFAEWLYAVLGSIGAAIFGSFNPLLAYVIALIVTAYYRGDEGHHLSQEVDK
WCLIIACMGIVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEAGWFDEEENSADTLSMRLANDATFVRAAFSNRLS
IFIQDSAAIIVAVLIGMLLQWRLALVALATLPILTISAIAQKLWLAGFSRGIQEMHRKASLVLEDAVRNIYTVVAFCAGN
KVMELYRLQLKKIFKQSFFHGMAIGFAFGFSQFLLFACNALLLWYTAISVRNKYMDLPTAIKEYMVFSFATFALVEPFGL
APYILKRRKSLISVFEIIDRVPKIEPDENSAMKPPNVYGSIELKNVDFCYPTRPELLVLSNFSLKVNGGQTVAVVGVSGS
GKSTIISLIERFYDPVAGQVLLDGRDLKVYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEIKEAARIANAHH
FISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAA
MMRHVDNIVVLNGGRIVEEGSHDSLMAKNGLYVRLMQPHFGKGLRQHRLV*

DNA
ATGATGATCTCTCGGGGGCTGTTCGGGTGGTCGCCCCCGCACATACAGCCCTTGACGCCGGTCTCCGAGGTGTCCGAGCC
GCCCGAGTCGCCGTCGCCGTACATGGACCAGAGTGCCGACGCGTCAGCCCAGCCGATGGAGCAGGAGGAGGAGATGGAGG
AGCCGGAGGAGATCGAGCCGCCGCCGGCCGCCGTGCCCTTCTCGCGGCTCTTCACCTGCGCGGACCGCCTCGATTGGGTT
CTCATGACCGTTGGATCGCTCGCCGCCGCGGCTCACGGGACGGCTCTCGTGGTGTACTTGCACTACTTCGCGAAGATAAT
TCAGATACTCTGGATGGGCAAAAACCACCCAGGCGACCAGCCGCCGCCGACTGATATTAGCGAGGAGCAGTTCCAGAAGT
TTATGGATCTTGCTTTATCCATCATTTATATTGCCACAGGCGTTTTTGCTGCTGGCTGGATTGAGGTCTCATGCTGGATT
CTGACGGGAGAAAGGCAGACTGCTGTCATCAGGTCAAACTATGTTCAAGTATTACTTAATCAGGATATGAGTTTTTTTGA
TACCTACGGGAACAACGGGGACATTGTGAGCCAAGTATTGAGTGATGTGCTGCTCATTCAGTCTGCTCTTAGTGAAAAAG
TTGGGAACTATATTCATAACATGGCTACATTTTTCAGTGGTCTCATTATTGGATTCATCAACTGTTGGCAGATTGCGGCA
ATAACATTGGCCACTGGCCCATTTATTGTTGCTGCTGGAGGAATATCAAACATATTTCTCCATAGGCTTGCTGAGAATAT
TCAAGATGCATACGCTGAAGCAGCTAGCATTGCAGAACAGGCAGTCTCTTACATTAGGACGTTATATGCATTTACAAACG
AAACATTAGCCAAGTATTCGTATGCAACATCACTGCAAGCAACTCTCAGATATGGCATATTGATAAGCCTTGTGCAAGGA
CTTGGACTTGGATTTACTTATGGTCTTGCCATTTGTTCTTGTGCCTTGCAACTGTGGGTTGGAAGGTTCCTGGTTTCGCA
AGGGAAAGCTCATGGTGGTGAAATTATAACAGCCCTCTTTGCTGTAATATTAAGTGGCCTTGGTCTGAATCAAGCGGCAA
CAAACTTCTACTCATTTGATCAAGGTCGAATTGCTGCATTTAGACTTTTTGAGATGATAAGTCGATCATCTTCTACCGTT
AATCATGAGGGAACTACCCTAGTAACCGTGCAAGGAAATATTGAGTTTCGGAATGTATATTTCAGTTATCTATCTCGTCC
TGAGATCCCGATTTTGAGTGGTTTTTACCTCACTGTACCTGCTAAGAAAGCCGTGGCACTCGTCGGCAGGAATGGTTCTG
GAAAGAGCAGTATTATCCCCCTCATGGAGCGGTTTTATGATCCTACATTAGGAGAAGTTCTTTTGGACGGAGAAAACATA
AAGAACCTGAAACTGGAGTGGCTTAGAAGTCAGATAGGGCTAGTCACGCAGGAGCCTGCCTTGCTGAGTCTGAGTATAAG
AGATAATATTGCTTATGGCCGGGATGCTACAGTGGATCAAATTGAAGAAGCTGCTAAAATAGCGCATGCGCATACATTTA
TTACCTCACTTGAGGGATCATATGATACACAGGTGGGAAGAGCAGGCTTAGCATTGACGGAAGAGCAAAAAATAAAACTT
TCAATTGCCAGAGCTGTGCTGCTAAACCCGTCCATTCTTTTGCTTGATGAAGTCACTGGAGGACTTGATTTTGAGGCTGA
AAGAGCTGTTCAAGAAGCTCTAGATCTCCTCATGTTGGGTCGTTCAACTATAATTATAGCTCGGCGGCTTAGTCTTATAA
GGAACGCTGATTATATAGCTGTGATGGAGGAAGGCCAACTAGTTGAGATGGGTACGCATGATGAGTTACTAACTCTGGAT
GGCCTATATGCGGAGCTTCTCAAATGTGAAGAGGCTGCAAAACTTCCTAGGAGGATGCCATTGAGGAACTACAAGGAGAC
TGCAACCTTCCAAATTGAAAAGGATTCTTCGGCAAGTCATAGCTTCCAAGAACCATCATCTCCAAAAATGATGAAATCAC
CCTCGCTTCAGAGAGCTAGTGGCATGTTCCGGATGGGAGATGGCAATTTTAACTCAGAGGAGTCACCAAACGCTAGGAGT
CCTCCAGCAGAGAAAATGTTGGAAAATGGTCAGCCCTTGGATTCAGCAGATAAGGAACCATCAATAAAAAGGCAGGATAG
TTTTGAAATGAGACTACCTGAGTTACCCAAGATTGATGTCCAGTCTGTAAATCAACAGACATTGAATGGTTCGGACCCTG
AATCCCCCGTTTCACCCCTTTTGACATCTGATCCGAAAAATGAGCGTTCCCATTCACAAACCTTTAGCCGTCCACATAGC
CATTCGGATGATTTTCCCATGAAATTGAAGGAAGAAAAAAGCACACATCAAAAGAAGGCACCATCATTTTGGAGGCTTGC
ACAGCTTAGTTTTGCAGAGTGGCTTTATGCTGTGTTAGGAAGCATTGGTGCTGCTATCTTTGGTTCCTTTAATCCTCTTC
TCGCTTATGTTATTGCACTGATAGTAACAGCATACTACAGAGGTGATGAAGGTCATCACTTGAGTCAGGAAGTAGACAAA
TGGTGCTTGATCATTGCTTGCATGGGTATAGTGACAGTCGTTGCCAATTTCTTGCAGCATTTCTACTTTGGTATTATGGG
GGAGAAAATGACGGAACGAGTTCGTAGAATGATGTTCTCAGCAATGCTGCGCAATGAAGCTGGATGGTTTGATGAAGAAG
AGAACAGTGCCGATACCTTATCCATGCGCTTGGCAAATGATGCTACATTTGTACGGGCTGCTTTTAGCAATCGGCTTTCA
ATATTTATACAGGATAGTGCTGCTATTATTGTGGCTGTTCTCATTGGGATGTTGCTACAATGGCGATTAGCACTAGTGGC
TTTGGCAACTCTACCAATTCTCACTATTTCTGCCATTGCACAGAAATTATGGCTTGCTGGTTTCTCAAGGGGAATTCAGG
AGATGCACAGGAAGGCATCTTTGGTTCTCGAGGATGCAGTTAGAAACATTTACACTGTTGTAGCATTCTGTGCTGGTAAC
AAGGTAATGGAGCTGTACAGATTGCAGCTAAAGAAAATATTTAAGCAGAGTTTCTTTCATGGAATGGCCATTGGCTTTGC
ATTTGGCTTTTCGCAGTTCCTTCTTTTTGCCTGTAACGCCCTTCTTCTCTGGTACACTGCAATCTCTGTGAGAAATAAGT
ATATGGATCTACCTACTGCTATCAAGGAGTACATGGTTTTCTCTTTTGCTACATTCGCACTGGTAGAGCCTTTTGGGTTG
GCTCCTTACATACTAAAACGCCGTAAATCTCTCATTTCAGTATTTGAAATCATTGATCGAGTGCCAAAGATTGAGCCAGA
TGAAAACTCGGCAATGAAACCACCTAATGTTTATGGAAGCATTGAGTTGAAAAATGTTGACTTCTGTTATCCAACTCGCC
CAGAACTGTTGGTACTGAGCAATTTCAGTCTCAAAGTAAACGGAGGGCAAACTGTAGCTGTGGTGGGAGTTTCAGGATCA
GGAAAGAGCACTATAATTTCTTTGATTGAGAGATTTTATGATCCAGTTGCTGGCCAAGTCTTACTGGATGGCCGAGATCT
GAAAGTTTATAATTTGAGATGGTTGAGGAACCACCTAGGTCTTGTTCAGCAGGAGCCCATCATTTTCTCCACAACAATCA
GGGAAAATATAATATATGCAAGGCACAATGCTAGCGAAGCTGAGATCAAAGAGGCTGCAAGAATAGCAAATGCTCACCAT
TTCATCAGCAGCTTGCCTCATGGTTATGACACGCATGTGGGGATGAGAGGTGTTGACCTGACCCCAGGACAGAAACAGAG
AATTGCAATTGCTCGTGTCGTGCTAAAGAATGCTCCCATCTTGTTATTGGATGAAGCAAGCTCGTCCATTGAATCCGAGT
CAAGCCGAGTGGTGCAGGAGGCTCTTGATACATTAATCATGGGGAACAAAACAACCATTTTGATAGCCCATAGAGCTGCA
ATGATGAGGCATGTTGATAACATTGTAGTTCTCAATGGAGGGAGAATTGTGGAAGAAGGGTCCCATGATTCTTTAATGGC
AAAGAATGGTCTCTATGTCCGTTTGATGCAACCGCACTTTGGCAAGGGGTTGCGTCAACACCGACTTGTTTAG