Details for Oil palm Locus p5_sc00054.V1.gene573

Position : EG5_Chr3 ( 5`- 29520587 .. 29522127 -3` )
Annotation :
External links : CoGe
PGDD synteny : p5_sc00054.V1.gene573

Protein [Map View]
MEPGIGGSAVLRLALALAVASLLASPTRSLHFDLQSGKPKCITEDIKLRAMAVGKYTVVKPDGSSTLPDSHRITARISSP
NGNVIHSAEKVESGHFAFNALEAGNYLACFGTPVHEPPVTVTLDLDWRTGVATKDWTNIAKKEHLDFLFLWLSVLAIYR*

DNA
ATGGAGCCAGGAATTGGAGGATCGGCGGTTCTCCGCTTGGCGCTGGCCCTAGCGGTGGCCTCTCTCTTGGCCTCGCCCAC
CCGATCCCTCCACTTCGACCTCCAATCGGGCAAACCCAAGTGCATCACCGAGGACATCAAGCTCCGCGCCATGGCCGTCG
GCAAGTACACCGTCGTCAAACCCGACGGCTCTAGCACACTTCCCGACTCCCACCGCATCACCGCCCGGATTTCGTCGCCC
AATGGGAATGTCATCCACTCCGCGGAAAAAGTGGAGTCGGGGCATTTTGCTTTCAATGCGTTGGAGGCTGGGAATTACTT
GGCGTGCTTTGGGACGCCTGTCCACGAGCCGCCCGTCACGGTGACGCTCGATTTGGACTGGAGGACCGGCGTCGCCACCA
AAGACTGGACAAATATTGCTAAGAAGGAGCATCTTGATTTCCTTTTTCTGTGGTTGTCTGTGCTAGCTATCTACCGCTGA