Details for Oil palm Locus p5_sc00054.V1.gene565

Position : EG5_Chr3 ( 5`- 29468424 .. 29471788 -3` )
Annotation :
External links : CoGe
PGDD synteny : p5_sc00054.V1.gene565

Protein [Map View]
MSYMRGDLLMKTRKLVKGLAKTTPVWLKAMEQAPPVTFPRTDGKIKKIEMPEDVYVKRFFKKHPDSLYHDAMEYRVEKKA
KKKAPPPNPYPSAIKEIQAEEKKYVHDRFFNPKILEIVQKMKAEKAARMQDQQGGGDSGAGGGQPRGWNGEQRWCTPFMV
TGELR*

DNA
ATGTCGTACATGAGAGGAGATCTACTGATGAAGACGAGAAAGCTGGTGAAGGGCCTCGCCAAAACCACCCCTGTTTGGCT
GAAGGCCATGGAACAGGCACCGCCCGTAACGTTTCCTCGTACCGATGGAAAGATCAAGAAGATTGAGATGCCGGAGGATG
TTTACGTCAAGAGGTTCTTCAAGAAGCATCCGGATTCTCTCTACCACGACGCCATGGAATATCGTGTTGAGAAAAAAGCA
AAGAAGAAGGCACCACCTCCAAACCCATATCCAAGTGCCATAAAAGAGATACAAGCAGAGGAGAAGAAATATGTTCATGA
TCGTTTCTTTAATCCCAAGATACTTGAGATTGTGCAAAAAATGAAAGCTGAAAAGGCTGCACGGATGCAAGATCAACAAG
GAGGTGGTGATAGTGGTGCAGGTGGTGGCCAGCCTCGTGGCTGGAATGGCGAACAGCGCTGGTGTACTCCATTCATGGTT
ACTGGTGAACTCCGTTGA