Details for Sweet orange Locus orange1.1g047550m

Position : scaf_00015 ( 5`- 1297253 .. 1299071 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g047550m

Protein [Map View]
MTLQQFHNSTSCHKRKMNSMTNHYKNTINANAPTIDSSMDMFAAVAHMGSLSASPRKNSGHIVTSQNICYCDSSDHQKSD
LAAGGDSDNNNKVDESVDGYEDMEDVKKMDGGLSKVCSRGHWRPAEDSKLKELVALYGPQNWNLIAEKLEGRSGKSCRLR
WFNQLDPRINKRAFSEDEEERLMAAHRVYGNKWAMIARLFPGRTDNAVKNHWHVIMARKYREQSSAYYRRRKFLNQVVDD
KKLEAAVAANDLEPNINNVHDISSSSVSFLDSSSPRKPSFQAPIGYKSDDSFSQKSMQQWGMIMKDGASFTVSSPYTHHH
HHQQFLMPMQHSSNYHLSAAAGFSDTMASAASQVTITEPSASSSSSQSAAENKRGTSHLEATISPPFIDFLGVGA*

DNA
ATGACCTTGCAACAGTTCCACAACAGCACCTCCTGTCACAAAAGAAAAATGAATAGCATGACCAATCACTACAAAAACAC
TATCAATGCAAATGCACCTACCATTGATTCATCAATGGATATGTTTGCAGCAGTAGCACACATGGGTTCTCTCTCCGCTT
CTCCGAGAAAAAATAGTGGCCACATTGTCACCTCACAAAATATTTGTTACTGCGACAGTTCTGATCATCAGAAGAGTGAC
CTAGCAGCAGGAGGTGACAGTGACAATAATAACAAGGTTGATGAATCTGTTGATGGTTATGAAGACATGGAAGATGTGAA
GAAAATGGATGGTGGGCTGTCAAAAGTTTGTTCAAGAGGCCATTGGAGACCAGCTGAGGACTCAAAGCTCAAGGAACTTG
TGGCCCTTTATGGCCCTCAAAACTGGAACCTTATAGCAGAGAAGTTAGAAGGAAGATCAGGCAAGAGTTGCAGATTGAGA
TGGTTCAATCAATTGGATCCAAGGATAAACAAAAGGGCTTTTAGTGAAGATGAAGAGGAGAGGCTAATGGCAGCACATAG
AGTGTATGGCAACAAATGGGCTATGATAGCTAGGCTGTTCCCTGGAAGAACTGATAATGCTGTGAAAAACCATTGGCATG
TGATCATGGCAAGAAAATACAGGGAGCAATCAAGTGCTTATTATAGGAGGAGAAAATTTCTGAATCAGGTTGTTGATGAT
AAAAAATTGGAAGCTGCCGTCGCAGCCAATGACTTAGAACCTAACATTAACAACGTCCATGATATCAGCAGCAGCAGTGT
CAGCTTCTTAGACTCATCATCACCACGGAAACCATCATTTCAAGCTCCCATTGGTTACAAAAGTGACGACAGTTTTAGCC
AGAAGAGCATGCAGCAATGGGGTATGATCATGAAAGATGGTGCAAGCTTCACAGTTTCAAGTCCCTATACACATCATCAT
CATCATCAACAATTTTTAATGCCAATGCAACATTCAAGCAACTATCATCTTTCAGCTGCTGCTGGTTTCTCAGACACCAT
GGCATCAGCAGCATCTCAAGTCACAATCACTGAACCATCAGCTTCATCATCGTCATCACAATCAGCTGCAGAAAACAAAA
GAGGAACTAGCCATTTAGAGGCTACAATATCACCACCATTTATAGATTTTCTTGGAGTAGGAGCCTGA