Details for Sweet orange Locus orange1.1g045454m

Position : scaf_00024 ( 5`- 176068 .. 176672 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g045454m

Protein [Map View]
CCRRDVEEDDDECRDHVEFASKNVHLITTMVSWEAKVSESIKDGKIVVANFSAQWCSPCKKIAPVYIQLADKYPSMICLT
VDVDELPEFSNSWGVTATPTFFFLKDGRQIDKLIGSNKLELQRKTAAVSKLLR*

DNA
TGTTGCAGACGCGATGTTGAGGAGGACGATGATGAGTGCCGTGATCATGTAGAGTTTGCCAGTAAAAATGTGCACCTTAT
AACTACCATGGTGAGCTGGGAGGCAAAGGTATCAGAATCAATCAAGGACGGCAAAATTGTTGTGGCAAATTTCAGTGCTC
AATGGTGTAGTCCTTGTAAGAAAATAGCACCAGTATATATTCAACTTGCTGATAAATATCCTTCTATGATATGTCTAACG
GTGGATGTGGATGAGCTTCCTGAATTCAGTAATTCATGGGGGGTCACGGCCACCCCAACATTCTTTTTCCTTAAAGATGG
ACGACAAATAGACAAACTTATCGGATCAAACAAGCTAGAGCTCCAGAGGAAGACAGCTGCCGTCTCTAAACTTTTGAGAT
AA