Details for Sweet orange Locus orange1.1g040567m

Position : scaf_00015 ( 5`- 1391047 .. 1392938 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g040567m

Protein [Map View]
VVNPNEGYPLPDTHKLTVKVTSPYGNSYHQGDHVESGNFAFTAAEAGDYTACFWSPEHNPPATVTVEFEWKTGVVSKDWT
KVAKKGQVDMMELELKKLFDTVSSIHEEMFYLREREEEMQELNKTTNSRMASLGFISLVVCLSVAALQIWHLKTFFERKK
LL*

DNA
GTTGTTAATCCAAATGAAGGCTACCCTTTGCCTGATACGCACAAGCTCACTGTTAAGGTGACTTCGCCTTATGGGAACAG
TTACCACCAGGGGGATCACGTGGAGTCGGGTAATTTTGCATTTACTGCAGCTGAAGCTGGTGACTATACTGCTTGCTTTT
GGTCACCTGAGCACAACCCACCAGCAACTGTGACAGTTGAATTTGAGTGGAAGACCGGTGTAGTTTCCAAGGATTGGACT
AAGGTTGCTAAGAAAGGGCAGGTTGACATGATGGAACTGGAGCTCAAGAAGTTATTTGATACCGTCTCATCCATTCATGA
AGAAATGTTTTATCTTCGTGAGAGGGAGGAAGAAATGCAAGAGCTTAATAAAACAACAAATTCCAGAATGGCGAGTCTTG
GATTCATTTCGCTTGTTGTTTGCCTATCCGTTGCTGCATTGCAAATATGGCATCTGAAGACCTTCTTTGAGAGGAAGAAG
CTCCTCTAG