Details for Sweet orange Locus orange1.1g040076m

Position : scaf_00024 ( 5`- 126687 .. 127703 -3` )
Annotation :
External links : CoGe
PGDD synteny : orange1.1g040076m

Protein [Map View]
MPVSNWPHQHKLPHIPFSGEATANRQHMSCSYMHCYSQDLQCSVPLPPPFLSHNKGLRSFPVHSGASCYNSYGPCPSRPQ
QFADSKFPLWHCETKSDYQRHEDHCLKEKHFVAKRHLRPTAGGAPFITCYSCLYPLQLPADFLVFKRRFHLLRCGACSKV
LKFSLKRRTHIVPYTPEAATPSPSQLVDYNDAINRRNSVSSSRGNGCSPADPVSCSDDYGLSHCKSCSTDGDPVIIAPFR
NGQGITGGRNFSYDSSESMKERPQFVRKQPGNKNKNPVEAQASPEPSSNKSRPGKISSEIEELPAKGSPLHQLMGYSSPS
QVLKGSGPSSSGTSSHYI*

DNA
ATGCCGGTGAGCAACTGGCCTCACCAGCATAAACTCCCACACATACCCTTCTCAGGGGAAGCAACAGCCAATAGACAGCA
TATGAGCTGCTCCTATATGCATTGCTATTCGCAAGACTTGCAGTGCTCAGTGCCATTGCCTCCACCCTTCCTTTCTCATA
ATAAAGGACTCCGTAGCTTCCCCGTCCACTCTGGTGCCAGTTGTTACAATTCCTATGGCCCTTGTCCCTCAAGGCCCCAA
CAATTTGCAGACTCCAAATTCCCCCTATGGCACTGTGAAACCAAGTCTGATTATCAAAGGCATGAAGATCATTGTTTGAA
GGAGAAACATTTCGTGGCAAAGAGACATCTCCGTCCCACAGCTGGAGGCGCCCCTTTCATAACTTGTTACAGTTGCTTGT
ATCCACTGCAGCTCCCAGCAGATTTTCTTGTCTTCAAAAGGAGGTTCCATCTGCTAAGGTGTGGTGCTTGTTCTAAGGTT
CTTAAGTTCTCACTTAAAAGAAGAACTCACATAGTTCCATATACACCAGAGGCTGCAACCCCTTCACCTAGTCAGCTTGT
TGACTACAATGATGCTATTAATAGAAGAAATTCAGTTTCTTCTTCTCGTGGCAACGGTTGTTCACCTGCTGACCCTGTCT
CCTGCTCAGATGATTATGGACTATCACATTGTAAAAGTTGCTCTACTGATGGAGATCCTGTTATCATTGCACCATTTCGC
AATGGCCAGGGAATCACAGGTGGCAGAAATTTTTCATATGATTCTTCTGAGTCAATGAAAGAGAGGCCACAGTTTGTTAG
AAAACAGCCTGGAAACAAAAATAAGAATCCTGTGGAAGCACAAGCATCACCAGAGCCTTCCTCGAATAAATCCAGACCAG
GGAAAATATCTTCAGAAATTGAGGAGTTGCCAGCAAAAGGTTCCCCTCTTCACCAGCTGATGGGATATTCTTCTCCTAGC
CAAGTGCTAAAGGGGTCTGGTCCATCTAGCTCTGGGACAAGCTCACACTACATATAA